BLASTX nr result
ID: Cnidium21_contig00032465
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00032465 (766 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002332110.1| predicted protein [Populus trichocarpa] gi|2... 63 8e-08 ref|XP_002521646.1| conserved hypothetical protein [Ricinus comm... 60 4e-07 ref|XP_002961432.1| hypothetical protein SELMODRAFT_164697 [Sela... 58 2e-06 ref|XP_002990270.1| hypothetical protein SELMODRAFT_185147 [Sela... 58 2e-06 >ref|XP_002332110.1| predicted protein [Populus trichocarpa] gi|222874930|gb|EEF12061.1| predicted protein [Populus trichocarpa] Length = 359 Score = 62.8 bits (151), Expect = 8e-08 Identities = 28/67 (41%), Positives = 46/67 (68%), Gaps = 1/67 (1%) Frame = -2 Query: 765 PWLGVEIADLHLTCLDFLEDVMEKFPNVATGVFVTQVAD-SPAYKSGIRRKDVIVECDGK 589 PWLG+ + + + LE++++KFP+++ G+ V V SPA +GI KD+IVECDG+ Sbjct: 290 PWLGMTLTNSYAAKASVLEEIIQKFPHISNGIIVKDVMKGSPAAHAGIVSKDIIVECDGE 349 Query: 588 LVRSTLE 568 +V+ +LE Sbjct: 350 VVKCSLE 356 >ref|XP_002521646.1| conserved hypothetical protein [Ricinus communis] gi|223539158|gb|EEF40753.1| conserved hypothetical protein [Ricinus communis] Length = 434 Score = 60.5 bits (145), Expect = 4e-07 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 1/67 (1%) Frame = -2 Query: 765 PWLGVEIADLHLTCLDFLEDVMEKFPNVATGVFVTQV-ADSPAYKSGIRRKDVIVECDGK 589 PWL +E+ +L+ LD LE +++KFPN GV V +V S A+ +GIR DVIV+ GK Sbjct: 301 PWLAMELTNLYAVRLDILEKIIQKFPNTFKGVMVEEVIPGSSAHSAGIRPNDVIVQFGGK 360 Query: 588 LVRSTLE 568 + S LE Sbjct: 361 TILSFLE 367 >ref|XP_002961432.1| hypothetical protein SELMODRAFT_164697 [Selaginella moellendorffii] gi|300170091|gb|EFJ36692.1| hypothetical protein SELMODRAFT_164697 [Selaginella moellendorffii] Length = 350 Score = 58.2 bits (139), Expect = 2e-06 Identities = 32/64 (50%), Positives = 41/64 (64%), Gaps = 1/64 (1%) Frame = -2 Query: 765 PWLGVEIADLHLTCLDFLEDVMEKFPNVATGVFVTQV-ADSPAYKSGIRRKDVIVECDGK 589 PWLG+++ +L +D L+D FPNV+ GV V QV SPA K G+R DVIVE DGK Sbjct: 248 PWLGIKMLELTEAIIDQLKDRDPSFPNVSKGVLVPQVIPGSPAEKGGLRPGDVIVEFDGK 307 Query: 588 LVRS 577 + S Sbjct: 308 PIDS 311 >ref|XP_002990270.1| hypothetical protein SELMODRAFT_185147 [Selaginella moellendorffii] gi|300141979|gb|EFJ08685.1| hypothetical protein SELMODRAFT_185147 [Selaginella moellendorffii] Length = 350 Score = 58.2 bits (139), Expect = 2e-06 Identities = 32/64 (50%), Positives = 41/64 (64%), Gaps = 1/64 (1%) Frame = -2 Query: 765 PWLGVEIADLHLTCLDFLEDVMEKFPNVATGVFVTQV-ADSPAYKSGIRRKDVIVECDGK 589 PWLG+++ +L +D L+D FPNV+ GV V QV SPA K G+R DVIVE DGK Sbjct: 248 PWLGIKMLELTEAIIDQLKDRDPSFPNVSKGVLVPQVIPGSPAEKGGLRPGDVIVEFDGK 307 Query: 588 LVRS 577 + S Sbjct: 308 PIDS 311