BLASTX nr result
ID: Cnidium21_contig00032463
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00032463 (336 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003627657.1| Acetyl-coenzyme A synthetase [Medicago trunc... 76 2e-12 ref|XP_003521941.1| PREDICTED: acyl-CoA synthetase family member... 76 3e-12 ref|XP_002325887.1| predicted protein [Populus trichocarpa] gi|2... 75 7e-12 ref|XP_002524008.1| AMP dependent ligase, putative [Ricinus comm... 72 4e-11 gb|AFW86153.1| hypothetical protein ZEAMMB73_432269 [Zea mays] 69 3e-10 >ref|XP_003627657.1| Acetyl-coenzyme A synthetase [Medicago truncatula] gi|355521679|gb|AET02133.1| Acetyl-coenzyme A synthetase [Medicago truncatula] Length = 1224 Score = 76.3 bits (186), Expect = 2e-12 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +1 Query: 25 CGSYDHNIYALDYRGYCCVYKLFCGGSIYGSPAIDEV 135 CGSYDH +YALDY+ +CCVYKL CGGSIYGSPAIDEV Sbjct: 968 CGSYDHTLYALDYKNHCCVYKLSCGGSIYGSPAIDEV 1004 >ref|XP_003521941.1| PREDICTED: acyl-CoA synthetase family member 4-like [Glycine max] Length = 1153 Score = 75.9 bits (185), Expect = 3e-12 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +1 Query: 25 CGSYDHNIYALDYRGYCCVYKLFCGGSIYGSPAIDEV 135 CGS+DHN+YALDY+ +CCVYKL CGGSIYGSPAIDEV Sbjct: 901 CGSHDHNLYALDYKKHCCVYKLSCGGSIYGSPAIDEV 937 >ref|XP_002325887.1| predicted protein [Populus trichocarpa] gi|222862762|gb|EEF00269.1| predicted protein [Populus trichocarpa] Length = 1058 Score = 74.7 bits (182), Expect = 7e-12 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +1 Query: 25 CGSYDHNIYALDYRGYCCVYKLFCGGSIYGSPAIDEV 135 CGS+DHN+YALDYR +CC+YKL C GSIYGSPAIDEV Sbjct: 800 CGSHDHNLYALDYRNHCCIYKLSCDGSIYGSPAIDEV 836 >ref|XP_002524008.1| AMP dependent ligase, putative [Ricinus communis] gi|223536735|gb|EEF38376.1| AMP dependent ligase, putative [Ricinus communis] Length = 1144 Score = 72.4 bits (176), Expect = 4e-11 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +1 Query: 25 CGSYDHNIYALDYRGYCCVYKLFCGGSIYGSPAIDEV 135 CGS+D+ +YALDYR YCC+YKL CGGS++GSPAIDEV Sbjct: 890 CGSHDNYLYALDYRNYCCIYKLLCGGSVFGSPAIDEV 926 >gb|AFW86153.1| hypothetical protein ZEAMMB73_432269 [Zea mays] Length = 918 Score = 69.3 bits (168), Expect = 3e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +1 Query: 25 CGSYDHNIYALDYRGYCCVYKLFCGGSIYGSPAIDEV 135 CGSYDH +YAL+Y+ CC YK+FCGGSIYGSPAID V Sbjct: 872 CGSYDHYLYALNYKDRCCTYKVFCGGSIYGSPAIDMV 908