BLASTX nr result
ID: Cnidium21_contig00032435
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00032435 (358 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_006665990.1| cytochrome c oxidase subunit 2 (mitochondrio... 76 2e-12 gb|AAB88906.1| cytochrome c oxidase subunit II [Brassica rapa su... 76 2e-12 dbj|BAD83476.2| cytochrome oxidase subunit 2 (mitochondrion) [Ni... 76 2e-12 ref|NP_064061.2| cox2 gene product (mitochondrion) [Beta vulgari... 76 2e-12 ref|YP_006460161.1| cytochrome c oxidase subunit II (mitochondri... 74 9e-12 >ref|YP_006665990.1| cytochrome c oxidase subunit 2 (mitochondrion) [Raphanus sativus] gi|2687657|gb|AAB88867.1| cytochrome c oxidase subunit II [Raphanus sativus] gi|400278265|dbj|BAM36189.1| cytochrome c oxidase subunit 2 (mitochondrion) [Raphanus sativus] gi|400278309|dbj|BAM36232.1| cytochrome c oxidase subunit 2 (mitochondrion) [Raphanus sativus] Length = 260 Score = 76.3 bits (186), Expect = 2e-12 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 357 SEICGTNHAFMPIVVEAVSRKDYGSWVSNQLIPQT 253 SEICGTNHAFMPIVVEAVSRKDYGSWVSNQLIPQT Sbjct: 223 SEICGTNHAFMPIVVEAVSRKDYGSWVSNQLIPQT 257 >gb|AAB88906.1| cytochrome c oxidase subunit II [Brassica rapa subsp. campestris] Length = 260 Score = 76.3 bits (186), Expect = 2e-12 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 357 SEICGTNHAFMPIVVEAVSRKDYGSWVSNQLIPQT 253 SEICGTNHAFMPIVVEAVSRKDYGSWVSNQLIPQT Sbjct: 223 SEICGTNHAFMPIVVEAVSRKDYGSWVSNQLIPQT 257 >dbj|BAD83476.2| cytochrome oxidase subunit 2 (mitochondrion) [Nicotiana tabacum] Length = 260 Score = 76.3 bits (186), Expect = 2e-12 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 357 SEICGTNHAFMPIVVEAVSRKDYGSWVSNQLIPQT 253 SEICGTNHAFMPIVVEAVSRKDYGSWVSNQLIPQT Sbjct: 223 SEICGTNHAFMPIVVEAVSRKDYGSWVSNQLIPQT 257 >ref|NP_064061.2| cox2 gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435041|ref|YP_004222256.1| cytochrome c oxidase subunit 2 [Beta vulgaris subsp. maritima] gi|346683134|ref|YP_004842063.1| cytochrome c oxidase subunit 2 [Beta macrocarpa] gi|87248025|gb|ABD36067.1| cytochrome oxidase subunit 2 [Beta vulgaris subsp. vulgaris] gi|148491430|dbj|BAA99453.2| cytochrome c oxidase subunit 2 [Beta vulgaris subsp. vulgaris] gi|317905694|emb|CBJ14086.1| cytochrome c oxidase subunit 2 [Beta vulgaris subsp. maritima] gi|319439774|emb|CBJ17495.1| cytochrome c oxidase subunit 2 [Beta vulgaris subsp. maritima] gi|345500052|emb|CBX24868.1| cytochrome c oxidase subunit 2 [Beta macrocarpa] gi|384939216|emb|CBL52062.2| cytochrome c oxidase subunit 2 (mitochondrion) [Beta vulgaris subsp. maritima] Length = 260 Score = 76.3 bits (186), Expect = 2e-12 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 357 SEICGTNHAFMPIVVEAVSRKDYGSWVSNQLIPQT 253 SEICGTNHAFMPIVVEAVSRKDYGSWVSNQLIPQT Sbjct: 223 SEICGTNHAFMPIVVEAVSRKDYGSWVSNQLIPQT 257 >ref|YP_006460161.1| cytochrome c oxidase subunit II (mitochondrion) [Mimulus guttatus] gi|340007652|gb|AEK26516.1| cytochrome c oxidase subunit 2 (mitochondrion) [Mimulus guttatus] Length = 260 Score = 74.3 bits (181), Expect = 9e-12 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -2 Query: 357 SEICGTNHAFMPIVVEAVSRKDYGSWVSNQLIPQT 253 SEICGTNHAFMPIVVEAV RKDYGSWVSNQLIPQT Sbjct: 223 SEICGTNHAFMPIVVEAVPRKDYGSWVSNQLIPQT 257