BLASTX nr result
ID: Cnidium21_contig00032161
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00032161 (625 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD63142.1| Retrotransposon gag protein [Asparagus officinalis] 68 8e-12 gb|ABB55347.1| hypothetical protein 9.t00011 [Asparagus officina... 62 8e-08 gb|ABG37655.1| integrase [Populus trichocarpa] 61 1e-07 gb|ABD63180.1| F7F22.15, related [Asparagus officinalis] 60 3e-07 gb|ABG37658.1| integrase [Populus trichocarpa] 59 7e-07 >gb|ABD63142.1| Retrotransposon gag protein [Asparagus officinalis] Length = 1788 Score = 68.2 bits (165), Expect(2) = 8e-12 Identities = 31/60 (51%), Positives = 39/60 (65%) Frame = -2 Query: 537 QANAVFQPNPRNDPFS*TYNPGWKNHPNFSWRQDQNHQSQPPSFQKTNQHSYPPQNLGPY 358 Q NA FQ PRNDPFS TYNPGW+NHPNF+W Q +H +Q +F + +P N P+ Sbjct: 224 QMNAAFQ-RPRNDPFSPTYNPGWRNHPNFAWNQGNSHGNQ--NFIPASNQQFPRGNTVPF 280 Score = 27.3 bits (59), Expect(2) = 8e-12 Identities = 11/19 (57%), Positives = 17/19 (89%) Frame = -1 Query: 331 DKRLNSLEKSLDALLKSTT 275 DKRL+ LEK L+A++K++T Sbjct: 310 DKRLSVLEKGLEAMIKAST 328 >gb|ABB55347.1| hypothetical protein 9.t00011 [Asparagus officinalis] Length = 149 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = -2 Query: 537 QANAVFQPNPRNDPFS*TYNPGWKNHPNFSWRQDQNHQSQ 418 Q NA FQ PRNDPFS TYNPGW+NHPNF+W Q + ++Q Sbjct: 104 QMNAAFQ-RPRNDPFSPTYNPGWRNHPNFAWNQGNSTRTQ 142 >gb|ABG37655.1| integrase [Populus trichocarpa] Length = 1263 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/61 (50%), Positives = 40/61 (65%), Gaps = 7/61 (11%) Frame = -2 Query: 537 QANAV--FQPNPRNDPFS*TYNPGWKNHPNFSWRQDQNH-QSQPPSFQK----TNQHSYP 379 QA+A+ FQ P ++P+S TYNPGW+NHPNFSW+ D N+ Q+ P FQ N H Y Sbjct: 535 QAHALNSFQ-RPNHNPYSQTYNPGWRNHPNFSWKSDNNNAQTSQPPFQAHHNFQNSHGYA 593 Query: 378 P 376 P Sbjct: 594 P 594 >gb|ABD63180.1| F7F22.15, related [Asparagus officinalis] Length = 481 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/58 (48%), Positives = 36/58 (62%) Frame = -2 Query: 531 NAVFQPNPRNDPFS*TYNPGWKNHPNFSWRQDQNHQSQPPSFQKTNQHSYPPQNLGPY 358 NA FQ +PRNDPFS TYNPGW+NHPNF+W + +Q F + +P N P+ Sbjct: 2 NAAFQ-HPRNDPFSPTYNPGWRNHPNFAWNLGNSPGTQ--HFTPASTQHFPKGNTTPH 56 >gb|ABG37658.1| integrase [Populus trichocarpa] Length = 1139 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/66 (46%), Positives = 41/66 (62%), Gaps = 7/66 (10%) Frame = -2 Query: 537 QANAV--FQPNPRNDPFS*TYNPGWKNHPNFSWRQDQNH-QSQPPSFQK----TNQHSYP 379 QA+A+ FQ P ++P+S TYNPGW+NHPNFSW+ + N+ Q+ P FQ N H Y Sbjct: 118 QAHALNNFQ-RPNHNPYSQTYNPGWRNHPNFSWKSENNNAQTSQPPFQAHHNFQNCHGYA 176 Query: 378 PQNLGP 361 P P Sbjct: 177 PPYAPP 182