BLASTX nr result
ID: Cnidium21_contig00032036
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00032036 (354 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004166586.1| PREDICTED: ethylene-responsive transcription... 73 2e-11 ref|XP_004149686.1| PREDICTED: floral homeotic protein APETALA 2... 73 2e-11 ref|XP_004148250.1| PREDICTED: ethylene-responsive transcription... 73 2e-11 ref|XP_004143690.1| PREDICTED: ethylene-responsive transcription... 73 2e-11 ref|XP_004141908.1| PREDICTED: floral homeotic protein APETALA 2... 73 2e-11 >ref|XP_004166586.1| PREDICTED: ethylene-responsive transcription factor RAP2-7-like [Cucumis sativus] Length = 476 Score = 73.2 bits (178), Expect = 2e-11 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +3 Query: 255 YRGVTFYRRTGRWESHIWDIEKQVYLGGFDTAH 353 YRGVTFYRRTGRWESHIWD KQVYLGGFDTAH Sbjct: 157 YRGVTFYRRTGRWESHIWDCGKQVYLGGFDTAH 189 >ref|XP_004149686.1| PREDICTED: floral homeotic protein APETALA 2-like [Cucumis sativus] gi|449521661|ref|XP_004167848.1| PREDICTED: floral homeotic protein APETALA 2-like [Cucumis sativus] Length = 483 Score = 73.2 bits (178), Expect = 2e-11 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +3 Query: 255 YRGVTFYRRTGRWESHIWDIEKQVYLGGFDTAH 353 YRGVTFYRRTGRWESHIWD KQVYLGGFDTAH Sbjct: 143 YRGVTFYRRTGRWESHIWDCGKQVYLGGFDTAH 175 >ref|XP_004148250.1| PREDICTED: ethylene-responsive transcription factor RAP2-7-like [Cucumis sativus] gi|449515297|ref|XP_004164686.1| PREDICTED: ethylene-responsive transcription factor RAP2-7-like [Cucumis sativus] Length = 497 Score = 73.2 bits (178), Expect = 2e-11 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +3 Query: 255 YRGVTFYRRTGRWESHIWDIEKQVYLGGFDTAH 353 YRGVTFYRRTGRWESHIWD KQVYLGGFDTAH Sbjct: 158 YRGVTFYRRTGRWESHIWDCGKQVYLGGFDTAH 190 >ref|XP_004143690.1| PREDICTED: ethylene-responsive transcription factor RAP2-7-like [Cucumis sativus] Length = 441 Score = 73.2 bits (178), Expect = 2e-11 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +3 Query: 255 YRGVTFYRRTGRWESHIWDIEKQVYLGGFDTAH 353 YRGVTFYRRTGRWESHIWD KQVYLGGFDTAH Sbjct: 139 YRGVTFYRRTGRWESHIWDCGKQVYLGGFDTAH 171 >ref|XP_004141908.1| PREDICTED: floral homeotic protein APETALA 2-like [Cucumis sativus] Length = 537 Score = 73.2 bits (178), Expect = 2e-11 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +3 Query: 255 YRGVTFYRRTGRWESHIWDIEKQVYLGGFDTAH 353 YRGVTFYRRTGRWESHIWD KQVYLGGFDTAH Sbjct: 181 YRGVTFYRRTGRWESHIWDCGKQVYLGGFDTAH 213