BLASTX nr result
ID: Cnidium21_contig00031818
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00031818 (254 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_173670.2| putative peptide/nitrate transporter [Arabidops... 57 2e-06 ref|XP_002890519.1| proton-dependent oligopeptide transport fami... 57 2e-06 gb|AAF18524.1|AC006551_10 Similar to peptide transporter [Arabid... 57 2e-06 ref|XP_003634606.1| PREDICTED: LOW QUALITY PROTEIN: probable pep... 56 3e-06 emb|CBI39335.3| unnamed protein product [Vitis vinifera] 56 3e-06 >ref|NP_173670.2| putative peptide/nitrate transporter [Arabidopsis thaliana] gi|122229980|sp|Q0WP01.1|PTR9_ARATH RecName: Full=Probable peptide/nitrate transporter At1g22540 gi|110738445|dbj|BAF01148.1| similar to peptide transporter [Arabidopsis thaliana] gi|190576483|gb|ACE79042.1| At1g22540 [Arabidopsis thaliana] gi|332192133|gb|AEE30254.1| putative peptide/nitrate transporter [Arabidopsis thaliana] Length = 557 Score = 57.0 bits (136), Expect = 2e-06 Identities = 20/32 (62%), Positives = 27/32 (84%) Frame = +2 Query: 38 NFFNWWYFGLCFGTIVTIVVLSHVLDNLRWVL 133 +FFNWWYFG+CFGT+ T+ VL+++ DNL W L Sbjct: 186 SFFNWWYFGMCFGTLTTLWVLNYIQDNLSWAL 217 >ref|XP_002890519.1| proton-dependent oligopeptide transport family protein [Arabidopsis lyrata subsp. lyrata] gi|297336361|gb|EFH66778.1| proton-dependent oligopeptide transport family protein [Arabidopsis lyrata subsp. lyrata] Length = 561 Score = 57.0 bits (136), Expect = 2e-06 Identities = 20/32 (62%), Positives = 27/32 (84%) Frame = +2 Query: 38 NFFNWWYFGLCFGTIVTIVVLSHVLDNLRWVL 133 +FFNWWYFG+CFGT+ T+ VL+++ DNL W L Sbjct: 190 SFFNWWYFGMCFGTLTTLWVLNYIQDNLSWAL 221 >gb|AAF18524.1|AC006551_10 Similar to peptide transporter [Arabidopsis thaliana] Length = 570 Score = 57.0 bits (136), Expect = 2e-06 Identities = 20/32 (62%), Positives = 27/32 (84%) Frame = +2 Query: 38 NFFNWWYFGLCFGTIVTIVVLSHVLDNLRWVL 133 +FFNWWYFG+CFGT+ T+ VL+++ DNL W L Sbjct: 199 SFFNWWYFGMCFGTLTTLWVLNYIQDNLSWAL 230 >ref|XP_003634606.1| PREDICTED: LOW QUALITY PROTEIN: probable peptide/nitrate transporter At1g22540-like [Vitis vinifera] Length = 572 Score = 56.2 bits (134), Expect = 3e-06 Identities = 20/32 (62%), Positives = 27/32 (84%) Frame = +2 Query: 38 NFFNWWYFGLCFGTIVTIVVLSHVLDNLRWVL 133 +FFNWWYFGLCFGT++T VL+++ +NL W L Sbjct: 195 SFFNWWYFGLCFGTVITYSVLTYIQENLNWGL 226 >emb|CBI39335.3| unnamed protein product [Vitis vinifera] Length = 687 Score = 56.2 bits (134), Expect = 3e-06 Identities = 20/32 (62%), Positives = 27/32 (84%) Frame = +2 Query: 38 NFFNWWYFGLCFGTIVTIVVLSHVLDNLRWVL 133 +FFNWWYFGLCFGT++T VL+++ +NL W L Sbjct: 338 SFFNWWYFGLCFGTVITYSVLTYIQENLNWGL 369