BLASTX nr result
ID: Cnidium21_contig00031649
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00031649 (325 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516608.1| conserved hypothetical protein [Ricinus comm... 62 4e-08 >ref|XP_002516608.1| conserved hypothetical protein [Ricinus communis] gi|223544428|gb|EEF45949.1| conserved hypothetical protein [Ricinus communis] Length = 194 Score = 62.4 bits (150), Expect = 4e-08 Identities = 39/105 (37%), Positives = 56/105 (53%), Gaps = 5/105 (4%) Frame = +1 Query: 25 MKGGTSSLNPYAAAYIPLSRRGISDGNKDFEVTASKSGDEGPQ-----PASATTHTQYQK 189 MK G S LNPYAA+Y+PLS+R + G + +KS G Q PA TT + + Sbjct: 1 MKPGVSRLNPYAASYVPLSKREAA-GKTEVPGLTTKSSHAGDQTIWFGPAEHTTQKKQHE 59 Query: 190 APRSYNVYGTVSEDSKLKGQSVNETYGSSSLYPDEMTEKHKLDDD 324 Y++ S LK + + YGSSS PD++TEK +++D Sbjct: 60 KTSDYDL-------SVLKSHTFHVAYGSSSQNPDDLTEKQTVNED 97