BLASTX nr result
ID: Cnidium21_contig00031607
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00031607 (246 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABI58290.1| ethylene control element variant [Malus x domestica] 79 4e-13 gb|ABI58288.1| ethylene control element [Malus x domestica] 79 4e-13 gb|ABI58289.1| ethylene control element variant [Malus x domestica] 79 4e-13 ref|XP_002528586.1| map3k delta-1 protein kinase, putative [Rici... 79 5e-13 gb|AAK40361.1| CTR1-like protein kinase [Rosa hybrid cultivar] 79 5e-13 >gb|ABI58290.1| ethylene control element variant [Malus x domestica] Length = 843 Score = 79.0 bits (193), Expect = 4e-13 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = +2 Query: 2 ECLGYVVLPIGNLSVGLCRHRAILFKVLADTIDLPCRIAKG 124 +CLG VV+PIG+LSVGLCRHRA+LFKVLADTIDLPCRIAKG Sbjct: 319 DCLGSVVVPIGSLSVGLCRHRALLFKVLADTIDLPCRIAKG 359 >gb|ABI58288.1| ethylene control element [Malus x domestica] Length = 809 Score = 79.0 bits (193), Expect = 4e-13 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = +2 Query: 2 ECLGYVVLPIGNLSVGLCRHRAILFKVLADTIDLPCRIAKG 124 +CLG VV+PIG+LSVGLCRHRA+LFKVLADTIDLPCRIAKG Sbjct: 319 DCLGSVVVPIGSLSVGLCRHRALLFKVLADTIDLPCRIAKG 359 >gb|ABI58289.1| ethylene control element variant [Malus x domestica] Length = 843 Score = 79.0 bits (193), Expect = 4e-13 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = +2 Query: 2 ECLGYVVLPIGNLSVGLCRHRAILFKVLADTIDLPCRIAKG 124 +CLG VV+PIG+LSVGLCRHRA+LFKVLADTIDLPCRIAKG Sbjct: 319 DCLGSVVVPIGSLSVGLCRHRALLFKVLADTIDLPCRIAKG 359 >ref|XP_002528586.1| map3k delta-1 protein kinase, putative [Ricinus communis] gi|223531982|gb|EEF33794.1| map3k delta-1 protein kinase, putative [Ricinus communis] Length = 871 Score = 78.6 bits (192), Expect = 5e-13 Identities = 35/41 (85%), Positives = 40/41 (97%) Frame = +2 Query: 2 ECLGYVVLPIGNLSVGLCRHRAILFKVLADTIDLPCRIAKG 124 +CLG +V+PIG+LSVGLCRHRA+LFKVLADTIDLPCRIAKG Sbjct: 338 DCLGSIVVPIGSLSVGLCRHRALLFKVLADTIDLPCRIAKG 378 >gb|AAK40361.1| CTR1-like protein kinase [Rosa hybrid cultivar] Length = 847 Score = 78.6 bits (192), Expect = 5e-13 Identities = 35/41 (85%), Positives = 40/41 (97%) Frame = +2 Query: 2 ECLGYVVLPIGNLSVGLCRHRAILFKVLADTIDLPCRIAKG 124 +CLG VV+PIG+LS+GLCRHRA+LFKVLADTIDLPCRIAKG Sbjct: 326 DCLGSVVVPIGSLSIGLCRHRALLFKVLADTIDLPCRIAKG 366