BLASTX nr result
ID: Cnidium21_contig00031587
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00031587 (426 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI27208.3| unnamed protein product [Vitis vinifera] 79 4e-13 ref|XP_002275152.1| PREDICTED: thioredoxin O1, mitochondrial [Vi... 79 4e-13 ref|XP_002879529.1| hypothetical protein ARALYDRAFT_482466 [Arab... 77 1e-12 dbj|BAC43652.1| putative thioredoxin [Arabidopsis thaliana] 75 4e-12 ref|NP_181046.1| thioredoxin O1 [Arabidopsis thaliana] gi|145330... 75 4e-12 >emb|CBI27208.3| unnamed protein product [Vitis vinifera] Length = 208 Score = 79.0 bits (193), Expect = 4e-13 Identities = 37/58 (63%), Positives = 45/58 (77%) Frame = -1 Query: 426 HVTTYKVDIDHKGLGNALSNMDIHSVPTVHLFRNGLKANEVIGADVQLLKNIMEKLYK 253 HVTTYK+DID GL N L ++I SVPT+H F+NG KA E+IGADV LK+ M+KLYK Sbjct: 149 HVTTYKIDIDQDGLENTLRRLNIASVPTLHFFQNGKKAAEIIGADVARLKDTMDKLYK 206 >ref|XP_002275152.1| PREDICTED: thioredoxin O1, mitochondrial [Vitis vinifera] gi|359473079|ref|XP_003631244.1| PREDICTED: thioredoxin O1, mitochondrial-like [Vitis vinifera] gi|297738008|emb|CBI27209.3| unnamed protein product [Vitis vinifera] Length = 186 Score = 79.0 bits (193), Expect = 4e-13 Identities = 37/58 (63%), Positives = 45/58 (77%) Frame = -1 Query: 426 HVTTYKVDIDHKGLGNALSNMDIHSVPTVHLFRNGLKANEVIGADVQLLKNIMEKLYK 253 HVTTYK+DID GL N L ++I SVPT+H F+NG KA E+IGADV LK+ M+KLYK Sbjct: 127 HVTTYKIDIDQDGLENTLRRLNIASVPTLHFFQNGKKAAEIIGADVARLKDTMDKLYK 184 >ref|XP_002879529.1| hypothetical protein ARALYDRAFT_482466 [Arabidopsis lyrata subsp. lyrata] gi|297325368|gb|EFH55788.1| hypothetical protein ARALYDRAFT_482466 [Arabidopsis lyrata subsp. lyrata] Length = 194 Score = 77.0 bits (188), Expect = 1e-12 Identities = 35/57 (61%), Positives = 44/57 (77%) Frame = -1 Query: 423 VTTYKVDIDHKGLGNALSNMDIHSVPTVHLFRNGLKANEVIGADVQLLKNIMEKLYK 253 VTTYKVDID G+ N +S ++I SVPT+H F+ G K EV+GADV LKN+ME+LYK Sbjct: 138 VTTYKVDIDEDGISNTISKLNITSVPTLHFFKGGSKKGEVVGADVTKLKNLMEQLYK 194 >dbj|BAC43652.1| putative thioredoxin [Arabidopsis thaliana] Length = 96 Score = 75.5 bits (184), Expect = 4e-12 Identities = 34/57 (59%), Positives = 44/57 (77%) Frame = -1 Query: 423 VTTYKVDIDHKGLGNALSNMDIHSVPTVHLFRNGLKANEVIGADVQLLKNIMEKLYK 253 VTTYKVDID G+ N +S ++I +VPT+H F+ G K EV+GADV LKN+ME+LYK Sbjct: 40 VTTYKVDIDEGGISNTISKLNITAVPTLHFFKGGSKKGEVVGADVTKLKNLMEQLYK 96 >ref|NP_181046.1| thioredoxin O1 [Arabidopsis thaliana] gi|145330362|ref|NP_001078006.1| thioredoxin O1 [Arabidopsis thaliana] gi|75099186|sp|O64764.1|TRXO1_ARATH RecName: Full=Thioredoxin O1, mitochondrial; Short=AtTrxo1; Flags: Precursor gi|3033396|gb|AAC12840.1| putative thioredoxin [Arabidopsis thaliana] gi|107738216|gb|ABF83663.1| At2g35010 [Arabidopsis thaliana] gi|330253954|gb|AEC09048.1| thioredoxin O1 [Arabidopsis thaliana] gi|330253955|gb|AEC09049.1| thioredoxin O1 [Arabidopsis thaliana] Length = 194 Score = 75.5 bits (184), Expect = 4e-12 Identities = 34/57 (59%), Positives = 44/57 (77%) Frame = -1 Query: 423 VTTYKVDIDHKGLGNALSNMDIHSVPTVHLFRNGLKANEVIGADVQLLKNIMEKLYK 253 VTTYKVDID G+ N +S ++I +VPT+H F+ G K EV+GADV LKN+ME+LYK Sbjct: 138 VTTYKVDIDEGGISNTISKLNITAVPTLHFFKGGSKKGEVVGADVTKLKNLMEQLYK 194