BLASTX nr result
ID: Cnidium21_contig00031496
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00031496 (363 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521646.1| conserved hypothetical protein [Ricinus comm... 64 1e-08 >ref|XP_002521646.1| conserved hypothetical protein [Ricinus communis] gi|223539158|gb|EEF40753.1| conserved hypothetical protein [Ricinus communis] Length = 434 Score = 63.9 bits (154), Expect = 1e-08 Identities = 27/52 (51%), Positives = 36/52 (69%), Gaps = 3/52 (5%) Frame = +1 Query: 217 GGAVINYSGEVIGLMF---CNTSFLPINIVSSWWNHFKSCRQYRRPWLGVEI 363 GG +IN GEVIG+ F C+T FLP+N+ S WWN +K + RRPWL +E+ Sbjct: 256 GGPLINRYGEVIGICFYDCCHTPFLPVNLASKWWNRYKKYGETRRPWLAMEL 307