BLASTX nr result
ID: Cnidium21_contig00031436
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00031436 (401 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274726.1| PREDICTED: signal peptide peptidase-like 2B ... 60 1e-07 emb|CAN62222.1| hypothetical protein VITISV_022532 [Vitis vinifera] 60 1e-07 ref|XP_003627574.1| Signal peptide peptidase-like 2B [Medicago t... 60 2e-07 ref|XP_003623971.1| Signal peptide peptidase-like 2B [Medicago t... 59 5e-07 ref|XP_003528851.1| PREDICTED: signal peptide peptidase-like 2B-... 58 7e-07 >ref|XP_002274726.1| PREDICTED: signal peptide peptidase-like 2B [Vitis vinifera] gi|297745304|emb|CBI40384.3| unnamed protein product [Vitis vinifera] Length = 534 Score = 60.5 bits (145), Expect = 1e-07 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = +2 Query: 299 CSSSLVFANDVVHHDNVAPKKPGCENNFVLVKVP 400 C+ ++ FA D+VH D++APKKPGCENNFVLVKVP Sbjct: 16 CTLTVAFAGDIVHQDDIAPKKPGCENNFVLVKVP 49 >emb|CAN62222.1| hypothetical protein VITISV_022532 [Vitis vinifera] Length = 489 Score = 60.5 bits (145), Expect = 1e-07 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = +2 Query: 299 CSSSLVFANDVVHHDNVAPKKPGCENNFVLVKVP 400 C+ ++ FA D+VH D++APKKPGCENNFVLVKVP Sbjct: 16 CTLTVAFAGDIVHQDDIAPKKPGCENNFVLVKVP 49 >ref|XP_003627574.1| Signal peptide peptidase-like 2B [Medicago truncatula] gi|355521596|gb|AET02050.1| Signal peptide peptidase-like 2B [Medicago truncatula] Length = 573 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 302 SSSLVFANDVVHHDNVAPKKPGCENNFVLVKVP 400 S SLV A D+VHHD+VAP +PGCENNFVLVKVP Sbjct: 19 SVSLVLAGDIVHHDDVAPTRPGCENNFVLVKVP 51 >ref|XP_003623971.1| Signal peptide peptidase-like 2B [Medicago truncatula] gi|355498986|gb|AES80189.1| Signal peptide peptidase-like 2B [Medicago truncatula] Length = 537 Score = 58.5 bits (140), Expect = 5e-07 Identities = 23/28 (82%), Positives = 27/28 (96%) Frame = +2 Query: 317 FANDVVHHDNVAPKKPGCENNFVLVKVP 400 FA D+VHHD++APKKPGC+NNFVLVKVP Sbjct: 21 FAGDIVHHDSIAPKKPGCDNNFVLVKVP 48 >ref|XP_003528851.1| PREDICTED: signal peptide peptidase-like 2B-like [Glycine max] Length = 541 Score = 58.2 bits (139), Expect = 7e-07 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +2 Query: 302 SSSLVFANDVVHHDNVAPKKPGCENNFVLVKVP 400 +++LV D+VHHD+VAP++PGCENNFVLVKVP Sbjct: 17 AATLVLGGDIVHHDDVAPRRPGCENNFVLVKVP 49