BLASTX nr result
ID: Cnidium21_contig00031245
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00031245 (292 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003552957.1| PREDICTED: U-box domain-containing protein 4... 67 1e-09 ref|XP_003538403.1| PREDICTED: U-box domain-containing protein 4... 67 1e-09 ref|XP_003545263.1| PREDICTED: U-box domain-containing protein 4... 67 2e-09 ref|XP_003519339.1| PREDICTED: U-box domain-containing protein 4... 66 3e-09 ref|XP_002273909.1| PREDICTED: U-box domain-containing protein 4... 64 2e-08 >ref|XP_003552957.1| PREDICTED: U-box domain-containing protein 4-like [Glycine max] Length = 384 Score = 67.4 bits (163), Expect = 1e-09 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -2 Query: 291 SGKAKQMLTEMVQVSMEQSLRHLQQRAMVCTPADMP 184 SGKAK+ML EMVQVSMEQSLRHLQQRA+VCTP+D+P Sbjct: 337 SGKAKKMLAEMVQVSMEQSLRHLQQRALVCTPSDLP 372 >ref|XP_003538403.1| PREDICTED: U-box domain-containing protein 4-like [Glycine max] Length = 392 Score = 67.4 bits (163), Expect = 1e-09 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -2 Query: 291 SGKAKQMLTEMVQVSMEQSLRHLQQRAMVCTPADMP 184 SGKAK+ML EMVQVSMEQSLRHLQQRA+VCTP+D+P Sbjct: 345 SGKAKKMLAEMVQVSMEQSLRHLQQRALVCTPSDLP 380 >ref|XP_003545263.1| PREDICTED: U-box domain-containing protein 4-like [Glycine max] Length = 371 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -2 Query: 291 SGKAKQMLTEMVQVSMEQSLRHLQQRAMVCTPADMP 184 SGKAK+ML EMVQVSMEQSLRHLQQRA+VCTP++MP Sbjct: 324 SGKAKKMLAEMVQVSMEQSLRHLQQRALVCTPSEMP 359 >ref|XP_003519339.1| PREDICTED: U-box domain-containing protein 4-like [Glycine max] Length = 371 Score = 65.9 bits (159), Expect = 3e-09 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = -2 Query: 291 SGKAKQMLTEMVQVSMEQSLRHLQQRAMVCTPADMP 184 SG+AK+ML EMVQVSMEQSLRHLQQRA+VCTP++MP Sbjct: 324 SGRAKKMLAEMVQVSMEQSLRHLQQRALVCTPSEMP 359 >ref|XP_002273909.1| PREDICTED: U-box domain-containing protein 4 [Vitis vinifera] gi|147807233|emb|CAN61950.1| hypothetical protein VITISV_002189 [Vitis vinifera] Length = 378 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -2 Query: 291 SGKAKQMLTEMVQVSMEQSLRHLQQRAMVCTPADMP 184 S KAK+ML EMVQVSMEQSLRHLQQRA+VCTP D+P Sbjct: 332 SRKAKKMLAEMVQVSMEQSLRHLQQRAVVCTPTDLP 367