BLASTX nr result
ID: Cnidium21_contig00031189
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00031189 (445 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530585.1| nascent polypeptide associated complex alpha... 81 1e-13 >ref|XP_002530585.1| nascent polypeptide associated complex alpha subunit, putative [Ricinus communis] gi|223529884|gb|EEF31815.1| nascent polypeptide associated complex alpha subunit, putative [Ricinus communis] Length = 687 Score = 80.9 bits (198), Expect = 1e-13 Identities = 42/109 (38%), Positives = 64/109 (58%), Gaps = 8/109 (7%) Frame = +1 Query: 52 LAKKRIPFRSIETWEYYLGERCLRQLGFPCQVPNHPPRKMYG------TKKGRS-GNGIS 210 L++KRI F +E+WE Y+GER LRQ G ++P+ PP + YG T R G+ Sbjct: 507 LSQKRIAFLGLESWELYMGERNLRQFGGGVRIPHSPPAERYGEGSQILTGAARKLLQGVD 566 Query: 211 AESLVEENR-EYASWFATNSIGRILDVNRFLGGPDIAGKVVDQWRAKHQ 354 A L+E+ Y WF NS+GRI+D+++F G + G++++ W HQ Sbjct: 567 AWDLLEDKEYSYVEWFRANSLGRIVDLDQFQGRKILGGRLLELWLRVHQ 615