BLASTX nr result
ID: Cnidium21_contig00031162
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00031162 (804 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004139764.1| PREDICTED: KH domain-containing protein At5g... 56 8e-06 >ref|XP_004139764.1| PREDICTED: KH domain-containing protein At5g56140-like [Cucumis sativus] gi|449508337|ref|XP_004163285.1| PREDICTED: KH domain-containing protein At5g56140-like [Cucumis sativus] Length = 296 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +3 Query: 696 SSYLHFDRYLSELIHERQKLSPFMPVLPNCYRLLNQ 803 ++ L ++YLSEL+ ERQKLSPFMPVLPN YRLLNQ Sbjct: 36 AAILEQEKYLSELLAERQKLSPFMPVLPNSYRLLNQ 71