BLASTX nr result
ID: Cnidium21_contig00031078
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00031078 (314 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313517.1| predicted protein [Populus trichocarpa] gi|2... 112 3e-23 ref|NP_200860.1| late embryogenesis abundant protein-like protei... 109 3e-22 ref|XP_002530294.1| structural constituent of cell wall, putativ... 104 8e-21 ref|XP_002530295.1| structural constituent of cell wall, putativ... 102 2e-20 ref|XP_002282268.1| PREDICTED: uncharacterized protein LOC100265... 101 7e-20 >ref|XP_002313517.1| predicted protein [Populus trichocarpa] gi|222849925|gb|EEE87472.1| predicted protein [Populus trichocarpa] Length = 343 Score = 112 bits (280), Expect = 3e-23 Identities = 52/66 (78%), Positives = 58/66 (87%) Frame = +3 Query: 3 QFKFSNLSDLVEGILGKTFRPGYVSQVKRGVAMPLMGGEDKYQTPSLYSPVCNVCRFQRQ 182 QFKF NL+DLVEG+LGKT+R GYVS VK GV MP+MGGEDKYQTPSLYSP+CNVCRFQ Q Sbjct: 278 QFKFFNLTDLVEGVLGKTYRAGYVSPVKIGVPMPMMGGEDKYQTPSLYSPLCNVCRFQPQ 337 Query: 183 SSVATM 200 S AT+ Sbjct: 338 SGTATI 343 >ref|NP_200860.1| late embryogenesis abundant protein-like protein [Arabidopsis thaliana] gi|9757754|dbj|BAB08235.1| unnamed protein product [Arabidopsis thaliana] gi|40823110|gb|AAR92259.1| At5g60520 [Arabidopsis thaliana] gi|332009956|gb|AED97339.1| late embryogenesis abundant protein-like protein [Arabidopsis thaliana] Length = 338 Score = 109 bits (272), Expect = 3e-22 Identities = 49/58 (84%), Positives = 54/58 (93%) Frame = +3 Query: 3 QFKFSNLSDLVEGILGKTFRPGYVSQVKRGVAMPLMGGEDKYQTPSLYSPVCNVCRFQ 176 QFKF NLSDLVEG+LGKT+RPGYVS VK GV MP+MGGEDKYQTPSL+SP+CNVCRFQ Sbjct: 271 QFKFFNLSDLVEGVLGKTYRPGYVSPVKTGVPMPMMGGEDKYQTPSLFSPLCNVCRFQ 328 >ref|XP_002530294.1| structural constituent of cell wall, putative [Ricinus communis] gi|223530192|gb|EEF32101.1| structural constituent of cell wall, putative [Ricinus communis] Length = 335 Score = 104 bits (259), Expect = 8e-21 Identities = 48/62 (77%), Positives = 52/62 (83%) Frame = +3 Query: 3 QFKFSNLSDLVEGILGKTFRPGYVSQVKRGVAMPLMGGEDKYQTPSLYSPVCNVCRFQRQ 182 QFKF NLSDLVEGILGKT+RP YVS VK GV MP+MGGEDKYQTPSL SP+C CRFQ+ Sbjct: 268 QFKFKNLSDLVEGILGKTYRPDYVSPVKTGVPMPMMGGEDKYQTPSLLSPLCKACRFQQS 327 Query: 183 SS 188 S Sbjct: 328 QS 329 >ref|XP_002530295.1| structural constituent of cell wall, putative [Ricinus communis] gi|223530193|gb|EEF32102.1| structural constituent of cell wall, putative [Ricinus communis] Length = 351 Score = 102 bits (255), Expect = 2e-20 Identities = 46/62 (74%), Positives = 55/62 (88%) Frame = +3 Query: 3 QFKFSNLSDLVEGILGKTFRPGYVSQVKRGVAMPLMGGEDKYQTPSLYSPVCNVCRFQRQ 182 QFKF NL+DLVEG+LGKT+RP YVS VK GV MP+MGGEDKY+ PS++SP+C+VCRFQRQ Sbjct: 280 QFKFFNLTDLVEGVLGKTYRPDYVSPVKIGVPMPMMGGEDKYRIPSIFSPLCSVCRFQRQ 339 Query: 183 SS 188 S Sbjct: 340 FS 341 >ref|XP_002282268.1| PREDICTED: uncharacterized protein LOC100265658 [Vitis vinifera] gi|297746242|emb|CBI16298.3| unnamed protein product [Vitis vinifera] Length = 368 Score = 101 bits (251), Expect = 7e-20 Identities = 44/60 (73%), Positives = 53/60 (88%) Frame = +3 Query: 3 QFKFSNLSDLVEGILGKTFRPGYVSQVKRGVAMPLMGGEDKYQTPSLYSPVCNVCRFQRQ 182 QF F NL++ VEG+LGKT+RPGYVS VKRGV MP+MGGEDKY+TPSL+SP+C +CRFQ Q Sbjct: 297 QFSFKNLTESVEGVLGKTYRPGYVSPVKRGVPMPVMGGEDKYRTPSLFSPLCKLCRFQPQ 356