BLASTX nr result
ID: Cnidium21_contig00031008
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00031008 (547 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529624.1| leucine-rich repeat containing protein, puta... 65 5e-09 ref|XP_002317122.1| nbs-lrr resistance protein [Populus trichoca... 60 2e-07 ref|XP_003628146.1| Disease resistance protein [Medicago truncat... 58 1e-06 ref|XP_002277987.1| PREDICTED: putative disease resistance prote... 58 1e-06 ref|XP_003553414.1| PREDICTED: disease resistance protein RGA2-l... 57 1e-06 >ref|XP_002529624.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223530909|gb|EEF32769.1| leucine-rich repeat containing protein, putative [Ricinus communis] Length = 860 Score = 65.5 bits (158), Expect = 5e-09 Identities = 30/77 (38%), Positives = 51/77 (66%), Gaps = 2/77 (2%) Frame = +1 Query: 1 QCPSLLALPQWLENCTSLLKLKLVNCSNLETLPLGVHQLTALRILFIKGCPLLNLSRESA 180 +C +L+ LP+WL++ SL KL ++ C L +LP+G+H+LT+LR L ++ CP L S Sbjct: 780 RCHNLVMLPEWLQDFISLQKLDILGCPGLSSLPIGLHRLTSLRKLTVEDCPALAESCNPE 839 Query: 181 GHMSW--ISNISEVYIN 225 W I+++SE+Y++ Sbjct: 840 TGKDWPQIAHVSEIYLD 856 >ref|XP_002317122.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222860187|gb|EEE97734.1| nbs-lrr resistance protein [Populus trichocarpa] Length = 1234 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/79 (35%), Positives = 45/79 (56%), Gaps = 2/79 (2%) Frame = +1 Query: 4 CPSLLALPQWLENCTSLLKLKLVNCSNLETLPLGVHQLTALRILFIKGCPLLNLSRESAG 183 CP ++ LP W+EN SL L + +C N+++ P G+ +L AL+ L I+GCP L + Sbjct: 1142 CPEVMELPAWVENLVSLRSLTISDCQNIKSFPQGLQRLRALQHLSIRGCPELEKRCQRGN 1201 Query: 184 HMSW--ISNISEVYINQDT 234 + W IS+ +Y+ T Sbjct: 1202 GVDWHKISHTPYIYVGLST 1220 >ref|XP_003628146.1| Disease resistance protein [Medicago truncatula] gi|355522168|gb|AET02622.1| Disease resistance protein [Medicago truncatula] Length = 274 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/76 (36%), Positives = 47/76 (61%), Gaps = 2/76 (2%) Frame = +1 Query: 4 CPSLLALPQWLENCTSLLKLKLVNCSNLETLPLGVHQLTALRILFIKGCPLLNLSRESAG 183 C SL+ LP ++ N TSL+++ + C NL LP+G LT+L++L I GC LL+ + Sbjct: 195 CVSLMTLPDFVRNLTSLMRVHIRYCPNLLNLPVGFGHLTSLQVLQIDGCHLLSRRCQRIA 254 Query: 184 HMSW--ISNISEVYIN 225 W I+++ E+Y++ Sbjct: 255 GEDWEKIAHVREIYVD 270 >ref|XP_002277987.1| PREDICTED: putative disease resistance protein RGA3-like [Vitis vinifera] Length = 874 Score = 57.8 bits (138), Expect = 1e-06 Identities = 30/77 (38%), Positives = 48/77 (62%), Gaps = 2/77 (2%) Frame = +1 Query: 1 QCPSLLALPQWLENCTSLLKLKLVNCSNLETLPLGVHQLTALRILFIKGCPLLNLSRESA 180 +C ALP+ LEN TSL +L++ +C L TL G+H+LT L++L I+ CP L+ + Sbjct: 788 RCHKFKALPESLENLTSLQELRIDDCPQLSTLSGGMHRLTTLKVLSIRDCPELSKRCKPE 847 Query: 181 GHMSW--ISNISEVYIN 225 W I+++ E+YI+ Sbjct: 848 IGEDWHKIAHVPEIYID 864 >ref|XP_003553414.1| PREDICTED: disease resistance protein RGA2-like [Glycine max] Length = 880 Score = 57.4 bits (137), Expect = 1e-06 Identities = 33/77 (42%), Positives = 43/77 (55%), Gaps = 2/77 (2%) Frame = +1 Query: 4 CPSLLALPQWLENCTSLLKLKLVNCSNLETLPLGVHQLTALRILFIKGCPLL--NLSRES 177 C SL LP+WL T L L +VNC L +LP +H LTAL +L I GCP L +S Sbjct: 785 CHSLKMLPEWLTTMTRLKTLHIVNCPQLLSLPSDMHHLTALEVLIIDGCPELCRKCQPQS 844 Query: 178 AGHMSWISNISEVYINQ 228 S+I++I V I + Sbjct: 845 GVCWSFIAHIKCVCIGE 861