BLASTX nr result
ID: Cnidium21_contig00030896
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00030896 (360 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276199.2| PREDICTED: lysosomal alpha-mannosidase-like ... 59 4e-07 emb|CBI21275.3| unnamed protein product [Vitis vinifera] 59 4e-07 ref|XP_003629280.1| Lysosomal alpha-mannosidase [Medicago trunca... 58 9e-07 ref|XP_002449583.1| hypothetical protein SORBIDRAFT_05g019600 [S... 57 2e-06 ref|XP_002303405.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 >ref|XP_002276199.2| PREDICTED: lysosomal alpha-mannosidase-like [Vitis vinifera] Length = 1027 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/38 (73%), Positives = 29/38 (76%), Gaps = 4/38 (10%) Frame = -1 Query: 360 DGRVNALYSTPSIYTD----VNALWPLKTDDFFPLCFH 259 DGRVNALYSTPSIYTD VN +WPLK DDFFP H Sbjct: 326 DGRVNALYSTPSIYTDAKYAVNKMWPLKKDDFFPYADH 363 >emb|CBI21275.3| unnamed protein product [Vitis vinifera] Length = 1013 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/38 (73%), Positives = 29/38 (76%), Gaps = 4/38 (10%) Frame = -1 Query: 360 DGRVNALYSTPSIYTD----VNALWPLKTDDFFPLCFH 259 DGRVNALYSTPSIYTD VN +WPLK DDFFP H Sbjct: 312 DGRVNALYSTPSIYTDAKYAVNKMWPLKKDDFFPYADH 349 >ref|XP_003629280.1| Lysosomal alpha-mannosidase [Medicago truncatula] gi|355523302|gb|AET03756.1| Lysosomal alpha-mannosidase [Medicago truncatula] Length = 1018 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/34 (79%), Positives = 28/34 (82%), Gaps = 4/34 (11%) Frame = -1 Query: 360 DGRVNALYSTPSIYTD----VNALWPLKTDDFFP 271 DGRVNALYSTPSIYTD N LWPLKTDD+FP Sbjct: 322 DGRVNALYSTPSIYTDAKNAANQLWPLKTDDYFP 355 >ref|XP_002449583.1| hypothetical protein SORBIDRAFT_05g019600 [Sorghum bicolor] gi|241935426|gb|EES08571.1| hypothetical protein SORBIDRAFT_05g019600 [Sorghum bicolor] Length = 1019 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/34 (79%), Positives = 28/34 (82%), Gaps = 4/34 (11%) Frame = -1 Query: 360 DGRVNALYSTPSIYTD----VNALWPLKTDDFFP 271 DGRVNALYSTPSIYTD N LWPLKT+DFFP Sbjct: 317 DGRVNALYSTPSIYTDAKYAANELWPLKTNDFFP 350 >ref|XP_002303405.1| predicted protein [Populus trichocarpa] gi|222840837|gb|EEE78384.1| predicted protein [Populus trichocarpa] Length = 1011 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/34 (79%), Positives = 28/34 (82%), Gaps = 4/34 (11%) Frame = -1 Query: 360 DGRVNALYSTPSIYTDV----NALWPLKTDDFFP 271 DGRVNALYSTPSIYTDV N WPLKTDD+FP Sbjct: 325 DGRVNALYSTPSIYTDVKNAANESWPLKTDDYFP 358