BLASTX nr result
ID: Cnidium21_contig00030657
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00030657 (310 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267584.1| PREDICTED: 65-kDa microtubule-associated pro... 78 8e-13 ref|XP_002513279.1| Protein regulator of cytokinesis, putative [... 67 1e-09 emb|CAN77019.1| hypothetical protein VITISV_039795 [Vitis vinifera] 67 1e-09 ref|XP_003536194.1| PREDICTED: 65-kDa microtubule-associated pro... 62 5e-08 gb|AAT40494.2| Putative microtubule-associated protein, identica... 62 6e-08 >ref|XP_002267584.1| PREDICTED: 65-kDa microtubule-associated protein 3 [Vitis vinifera] gi|296084125|emb|CBI24513.3| unnamed protein product [Vitis vinifera] Length = 730 Score = 77.8 bits (190), Expect = 8e-13 Identities = 52/103 (50%), Positives = 60/103 (58%), Gaps = 6/103 (5%) Frame = -3 Query: 308 LQKTVTSNITPFTTPTKLT----SIAYEENRTPAKTMTLPVPCTPKTVSVSMQTIMTPA- 144 L KTV+SN P+TTP+K S EENRTP KTM +PVP TP TVSV M T MTPA Sbjct: 633 LHKTVSSNNIPYTTPSKSQLPPPSATDEENRTP-KTMPIPVPSTPSTVSVPMLTAMTPAP 691 Query: 143 -PQPFACGATPIKXXXXXXXXXXXERRAGFVLTRLHPHTMLQV 18 P P A P++ ERRAGFVL + H T +QV Sbjct: 692 PPAPVPYNANPVE----ETEYSFEERRAGFVLPQAHLKTAIQV 730 >ref|XP_002513279.1| Protein regulator of cytokinesis, putative [Ricinus communis] gi|223547653|gb|EEF49147.1| Protein regulator of cytokinesis, putative [Ricinus communis] Length = 724 Score = 67.4 bits (163), Expect = 1e-09 Identities = 44/81 (54%), Positives = 52/81 (64%), Gaps = 3/81 (3%) Frame = -3 Query: 272 TTPTKLTSIAYEENRTPAKTMTLPVPCTPKTVSVSMQTIMTPA---PQPFACGATPIKXX 102 TTP+K T++A EEN TP KTM +PVP TP T+SV MQT +TPA P P+ GATP + Sbjct: 641 TTPSK-TTMADEENWTP-KTMPIPVPTTPSTLSVPMQTAITPAHPVPVPYG-GATPKEEV 697 Query: 101 XXXXXXXXXERRAGFVLTRLH 39 ERRAGFVL R H Sbjct: 698 PEEVEYSFEERRAGFVLPRTH 718 >emb|CAN77019.1| hypothetical protein VITISV_039795 [Vitis vinifera] Length = 1029 Score = 67.4 bits (163), Expect = 1e-09 Identities = 38/62 (61%), Positives = 42/62 (67%), Gaps = 4/62 (6%) Frame = -3 Query: 308 LQKTVTSNITPFTTPTKLT----SIAYEENRTPAKTMTLPVPCTPKTVSVSMQTIMTPAP 141 L KTV+SN P+TTP+K S EENRTP KTM +PVP TP TVSV M T MTPAP Sbjct: 600 LHKTVSSNNIPYTTPSKSQLPPPSATDEENRTP-KTMPIPVPSTPSTVSVPMLTAMTPAP 658 Query: 140 QP 135 P Sbjct: 659 PP 660 >ref|XP_003536194.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Glycine max] Length = 729 Score = 62.0 bits (149), Expect = 5e-08 Identities = 32/57 (56%), Positives = 40/57 (70%), Gaps = 1/57 (1%) Frame = -3 Query: 308 LQKTVTSNITPFTTPTKL-TSIAYEENRTPAKTMTLPVPCTPKTVSVSMQTIMTPAP 141 LQ+T++ N PFTTP+K T++ EENRTP K + +PVP TP TVSV M MTP P Sbjct: 632 LQRTLSLNNVPFTTPSKTATTVVDEENRTP-KAIPIPVPATPSTVSVPMNMAMTPVP 687 >gb|AAT40494.2| Putative microtubule-associated protein, identical [Solanum demissum] Length = 722 Score = 61.6 bits (148), Expect = 6e-08 Identities = 34/55 (61%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = -3 Query: 302 KTVTSN-ITPFTTPTKLTSIAYEENRTPAKTMTLPVPCTPKTVSVSMQTIMTPAP 141 KT+ SN TP +TP K S EENRTPAK M +PVP TP TVSV MQT TP P Sbjct: 632 KTLLSNHTTPVSTPVKSISTCEEENRTPAKAMPIPVPSTPSTVSVPMQT-TTPGP 685