BLASTX nr result
ID: Cnidium21_contig00030600
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00030600 (344 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522369.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002522369.1| conserved hypothetical protein [Ricinus communis] gi|223538447|gb|EEF40053.1| conserved hypothetical protein [Ricinus communis] Length = 550 Score = 54.7 bits (130), Expect = 8e-06 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 1/45 (2%) Frame = +2 Query: 2 RLRGFCLTISRLPTSYRKFDEVVKAIEL-SKQTEGYGVEDNDIEA 133 RL+GFCLT+SRLPTS R+F EVVKAIE +K++ G ED D+EA Sbjct: 504 RLQGFCLTLSRLPTSRRRFFEVVKAIEQDAKESNTLGDEDVDLEA 548