BLASTX nr result
ID: Cnidium21_contig00030564
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00030564 (371 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI29928.3| unnamed protein product [Vitis vinifera] 92 4e-17 ref|XP_002282210.1| PREDICTED: uncharacterized protein LOC100264... 92 4e-17 ref|XP_002319168.1| predicted protein [Populus trichocarpa] gi|2... 89 4e-16 ref|XP_002325827.1| predicted protein [Populus trichocarpa] gi|2... 87 1e-15 ref|XP_002525447.1| endonuclease, putative [Ricinus communis] gi... 85 5e-15 >emb|CBI29928.3| unnamed protein product [Vitis vinifera] Length = 187 Score = 92.0 bits (227), Expect = 4e-17 Identities = 42/54 (77%), Positives = 51/54 (94%) Frame = -2 Query: 370 KTLEEANMKLHKVPKAPKDYNIVTIPLTNSAIQMLKMRKGTPEEWQEYLA*PSS 209 KTLEEANMKL KVPKAPKDY+I+ IPLTN+AI+ML+MRKGTPEEW++YL+ PS+ Sbjct: 132 KTLEEANMKLSKVPKAPKDYDILAIPLTNTAIRMLRMRKGTPEEWRQYLSKPSA 185 >ref|XP_002282210.1| PREDICTED: uncharacterized protein LOC100264031 [Vitis vinifera] Length = 277 Score = 92.0 bits (227), Expect = 4e-17 Identities = 42/54 (77%), Positives = 51/54 (94%) Frame = -2 Query: 370 KTLEEANMKLHKVPKAPKDYNIVTIPLTNSAIQMLKMRKGTPEEWQEYLA*PSS 209 KTLEEANMKL KVPKAPKDY+I+ IPLTN+AI+ML+MRKGTPEEW++YL+ PS+ Sbjct: 222 KTLEEANMKLSKVPKAPKDYDILAIPLTNTAIRMLRMRKGTPEEWRQYLSKPSA 275 >ref|XP_002319168.1| predicted protein [Populus trichocarpa] gi|222857544|gb|EEE95091.1| predicted protein [Populus trichocarpa] Length = 272 Score = 89.0 bits (219), Expect = 4e-16 Identities = 42/54 (77%), Positives = 49/54 (90%) Frame = -2 Query: 370 KTLEEANMKLHKVPKAPKDYNIVTIPLTNSAIQMLKMRKGTPEEWQEYLA*PSS 209 KT EEANMKL KVPKAPKDY+I+ IPLT++AI+ML+MRKG PEEWQ+YLA PSS Sbjct: 217 KTPEEANMKLSKVPKAPKDYDILAIPLTSAAIRMLRMRKGMPEEWQQYLARPSS 270 >ref|XP_002325827.1| predicted protein [Populus trichocarpa] gi|222862702|gb|EEF00209.1| predicted protein [Populus trichocarpa] Length = 194 Score = 87.4 bits (215), Expect = 1e-15 Identities = 41/54 (75%), Positives = 49/54 (90%) Frame = -2 Query: 370 KTLEEANMKLHKVPKAPKDYNIVTIPLTNSAIQMLKMRKGTPEEWQEYLA*PSS 209 KT EEANMKL KVPKAPKDY+I+ IPLT++AI+ML++RKG PEEWQ+YLA PSS Sbjct: 140 KTPEEANMKLSKVPKAPKDYDILAIPLTSAAIRMLRIRKGMPEEWQQYLARPSS 193 >ref|XP_002525447.1| endonuclease, putative [Ricinus communis] gi|223535260|gb|EEF36937.1| endonuclease, putative [Ricinus communis] Length = 275 Score = 85.1 bits (209), Expect = 5e-15 Identities = 40/54 (74%), Positives = 49/54 (90%) Frame = -2 Query: 370 KTLEEANMKLHKVPKAPKDYNIVTIPLTNSAIQMLKMRKGTPEEWQEYLA*PSS 209 KT EEANMKL KVPKAPK+Y+I+ IPLT++AI+ML+MRKG PEEW++YLA PSS Sbjct: 220 KTPEEANMKLIKVPKAPKEYDILAIPLTSAAIRMLRMRKGMPEEWRQYLARPSS 273