BLASTX nr result
ID: Cnidium21_contig00030501
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00030501 (686 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAM63264.1| zinc finger protein-like [Arabidopsis thaliana] 59 9e-07 ref|NP_568920.1| Dof zinc finger protein DOF5.3 [Arabidopsis tha... 59 9e-07 ref|XP_002864673.1| Dof-type zinc finger domain-containing prote... 59 9e-07 dbj|BAA97501.1| Dof6 zinc finger protein-like [Arabidopsis thali... 59 9e-07 ref|XP_004163372.1| PREDICTED: dof zinc finger protein DOF5.3-li... 59 1e-06 >gb|AAM63264.1| zinc finger protein-like [Arabidopsis thaliana] Length = 239 Score = 58.9 bits (141), Expect = 9e-07 Identities = 26/49 (53%), Positives = 28/49 (57%) Frame = +3 Query: 3 YFCKSCRRYWTRGGTLRNVPVGGGXXXXXXXXXXXXXXXXIVPGLACHD 149 YFCKSCRRYWT+GGTLRN+PVGGG P A HD Sbjct: 62 YFCKSCRRYWTKGGTLRNIPVGGGCRKNKRSTSSAARSLRTTPEPASHD 110 >ref|NP_568920.1| Dof zinc finger protein DOF5.3 [Arabidopsis thaliana] gi|55583930|sp|Q84TE9.1|DOF53_ARATH RecName: Full=Dof zinc finger protein DOF5.3; Short=AtDOF5.3 gi|29028844|gb|AAO64801.1| At5g60200 [Arabidopsis thaliana] gi|110736341|dbj|BAF00140.1| zinc finger protein - like [Arabidopsis thaliana] gi|225879142|dbj|BAH30641.1| hypothetical protein [Arabidopsis thaliana] gi|332009909|gb|AED97292.1| Dof zinc finger protein DOF5.3 [Arabidopsis thaliana] Length = 257 Score = 58.9 bits (141), Expect = 9e-07 Identities = 26/49 (53%), Positives = 28/49 (57%) Frame = +3 Query: 3 YFCKSCRRYWTRGGTLRNVPVGGGXXXXXXXXXXXXXXXXIVPGLACHD 149 YFCKSCRRYWT+GGTLRN+PVGGG P A HD Sbjct: 80 YFCKSCRRYWTKGGTLRNIPVGGGCRKNKRSTSSAARSLRTTPEPASHD 128 >ref|XP_002864673.1| Dof-type zinc finger domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297310508|gb|EFH40932.1| Dof-type zinc finger domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 259 Score = 58.9 bits (141), Expect = 9e-07 Identities = 26/49 (53%), Positives = 28/49 (57%) Frame = +3 Query: 3 YFCKSCRRYWTRGGTLRNVPVGGGXXXXXXXXXXXXXXXXIVPGLACHD 149 YFCKSCRRYWT+GGTLRN+PVGGG P A HD Sbjct: 82 YFCKSCRRYWTKGGTLRNIPVGGGCRKNKRSTSSVTRSLRTTPEPASHD 130 >dbj|BAA97501.1| Dof6 zinc finger protein-like [Arabidopsis thaliana] Length = 237 Score = 58.9 bits (141), Expect = 9e-07 Identities = 26/49 (53%), Positives = 28/49 (57%) Frame = +3 Query: 3 YFCKSCRRYWTRGGTLRNVPVGGGXXXXXXXXXXXXXXXXIVPGLACHD 149 YFCKSCRRYWT+GGTLRN+PVGGG P A HD Sbjct: 60 YFCKSCRRYWTKGGTLRNIPVGGGCRKNKRSTSSAARSLRTTPEPASHD 108 >ref|XP_004163372.1| PREDICTED: dof zinc finger protein DOF5.3-like [Cucumis sativus] Length = 266 Score = 58.5 bits (140), Expect = 1e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = +3 Query: 3 YFCKSCRRYWTRGGTLRNVPVGGG 74 YFCKSCRRYWT+GGTLRNVPVGGG Sbjct: 68 YFCKSCRRYWTKGGTLRNVPVGGG 91