BLASTX nr result
ID: Cnidium21_contig00030290
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00030290 (467 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF52855.1| repressor of silencing 1 [Nicotiana tabacum] 55 5e-06 >dbj|BAF52855.1| repressor of silencing 1 [Nicotiana tabacum] Length = 1796 Score = 55.5 bits (132), Expect = 5e-06 Identities = 32/74 (43%), Positives = 42/74 (56%), Gaps = 2/74 (2%) Frame = -3 Query: 459 SPNESNCSTSAPVSKEEHATRMKRGHP--SAAVDLYITNIIGADHNSVQAYLAMFXXXXX 286 SPN SNCS+SA + +E +KR H + +LY TN++GA NS+QAY A+ Sbjct: 461 SPNGSNCSSSACLIQETPERALKRRHSFRTNEAELYSTNVMGAYFNSMQAYQAILPANEP 520 Query: 285 XXXXXXGMHFPAIY 244 GMHFP IY Sbjct: 521 YAHSTQGMHFPTIY 534