BLASTX nr result
ID: Cnidium21_contig00029880
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00029880 (321 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABV89751.1| purple acid phosphatase 12 protein family isoform... 57 2e-06 ref|XP_002263971.1| PREDICTED: purple acid phosphatase 2 isoform... 57 2e-06 ref|XP_002264050.1| PREDICTED: purple acid phosphatase 2 isoform... 57 2e-06 ref|XP_002263937.1| PREDICTED: purple acid phosphatase 2 isoform... 57 2e-06 gb|AAA91803.1| secreted purple acid phosphatase precursor [Arabi... 56 3e-06 >gb|ABV89751.1| purple acid phosphatase 12 protein family isoform 5 premature 2 [Brassica napus] gi|157849927|gb|ABV89754.1| purple acid phosphatase 12 protein family isoform 5 premature 2 [Brassica napus] Length = 246 Score = 57.0 bits (136), Expect = 2e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -3 Query: 319 RSTAYQPWIWTAGNHEIDFVPEIVRI 242 RS AYQPWIWTAGNHEIDFVP+IVR+ Sbjct: 221 RSAAYQPWIWTAGNHEIDFVPDIVRL 246 >ref|XP_002263971.1| PREDICTED: purple acid phosphatase 2 isoform 2 [Vitis vinifera] Length = 446 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 319 RSTAYQPWIWTAGNHEIDFVPEIVRINCFK 230 RSTAYQPWIWTAGNHEIDFVPEI FK Sbjct: 198 RSTAYQPWIWTAGNHEIDFVPEIGEFIPFK 227 >ref|XP_002264050.1| PREDICTED: purple acid phosphatase 2 isoform 3 [Vitis vinifera] Length = 447 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 319 RSTAYQPWIWTAGNHEIDFVPEIVRINCFK 230 RSTAYQPWIWTAGNHEIDFVPEI FK Sbjct: 224 RSTAYQPWIWTAGNHEIDFVPEIGEFIPFK 253 >ref|XP_002263937.1| PREDICTED: purple acid phosphatase 2 isoform 1 [Vitis vinifera] gi|297744760|emb|CBI38022.3| unnamed protein product [Vitis vinifera] Length = 472 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 319 RSTAYQPWIWTAGNHEIDFVPEIVRINCFK 230 RSTAYQPWIWTAGNHEIDFVPEI FK Sbjct: 224 RSTAYQPWIWTAGNHEIDFVPEIGEFIPFK 253 >gb|AAA91803.1| secreted purple acid phosphatase precursor [Arabidopsis thaliana] Length = 469 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = -3 Query: 319 RSTAYQPWIWTAGNHEIDFVPEIVRINCFK 230 RS AYQPWIWTAGNHEIDFVP+I I FK Sbjct: 221 RSVAYQPWIWTAGNHEIDFVPDIGEIEPFK 250