BLASTX nr result
ID: Cnidium21_contig00029745
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00029745 (322 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524855.1| ATP binding protein, putative [Ricinus commu... 55 6e-06 >ref|XP_002524855.1| ATP binding protein, putative [Ricinus communis] gi|223535818|gb|EEF37479.1| ATP binding protein, putative [Ricinus communis] Length = 673 Score = 55.1 bits (131), Expect = 6e-06 Identities = 30/69 (43%), Positives = 41/69 (59%) Frame = -1 Query: 208 GTEVIEGIVPRKVYYWDTDDALTGESFALETFKKMRKLRFLYLRKVHLTGSFEQTFQDLR 29 GTE +EG+V + + DA+ + E+F MR LR L + KVHLTG +E ++LR Sbjct: 539 GTEAVEGLV---LDVESSRDAV----LSTESFANMRYLRLLKINKVHLTGCYEHLSKELR 591 Query: 28 WLYWDWCPL 2 WL W CPL Sbjct: 592 WLCWHSCPL 600