BLASTX nr result
ID: Cnidium21_contig00029634
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00029634 (283 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513559.1| receptor serine/threonine kinase, putative [... 55 8e-06 >ref|XP_002513559.1| receptor serine/threonine kinase, putative [Ricinus communis] gi|223547467|gb|EEF48962.1| receptor serine/threonine kinase, putative [Ricinus communis] Length = 605 Score = 54.7 bits (130), Expect = 8e-06 Identities = 31/95 (32%), Positives = 50/95 (52%), Gaps = 6/95 (6%) Frame = +3 Query: 6 YTFFNCSSSSAVTEYTGNTVNSSINKDFKDVHVFHSDANPILMLPSIKSCTKLYNISHVP 185 +T F+CS V+ G ++ N + + F+S + I +PS+ SCTKLYN+S VP Sbjct: 128 FTVFSCSIGEFVSWSEGYILSCVNNSPDRGIIAFYSRRS-INYMPSLLSCTKLYNVSSVP 186 Query: 186 YD------QGGLSWSEPDCSDCEAKVQYCKFKPNS 272 ++ + WS P+C CEA+ + C+ S Sbjct: 187 HNMLFPERKIIFKWSTPNCRKCEAEGKLCRLNETS 221