BLASTX nr result
ID: Cnidium21_contig00029490
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00029490 (444 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC62794.1| T2L5.6 gene product [Arabidopsis thaliana] 55 5e-06 ref|NP_851092.1| Heparanase-like protein 3 [Arabidopsis thaliana... 55 5e-06 ref|NP_851093.1| Heparanase-like protein 3 [Arabidopsis thaliana... 55 5e-06 dbj|BAB10787.1| unnamed protein product [Arabidopsis thaliana] 55 5e-06 ref|XP_004159389.1| PREDICTED: LOW QUALITY PROTEIN: heparanase-l... 55 6e-06 >gb|AAC62794.1| T2L5.6 gene product [Arabidopsis thaliana] Length = 190 Score = 55.5 bits (132), Expect = 5e-06 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = -2 Query: 440 PVHVNSTEPIEVAPYSIVFVHLPDVVLPAC 351 P+H+NSTEPI +APYSIVFVH+ +VV+PAC Sbjct: 160 PIHINSTEPITIAPYSIVFVHMRNVVVPAC 189 >ref|NP_851092.1| Heparanase-like protein 3 [Arabidopsis thaliana] gi|332006539|gb|AED93922.1| Heparanase-like protein 3 [Arabidopsis thaliana] Length = 401 Score = 55.5 bits (132), Expect = 5e-06 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = -2 Query: 440 PVHVNSTEPIEVAPYSIVFVHLPDVVLPAC 351 P+H+NSTEPI +APYSIVFVH+ +VV+PAC Sbjct: 371 PIHINSTEPITIAPYSIVFVHMRNVVVPAC 400 >ref|NP_851093.1| Heparanase-like protein 3 [Arabidopsis thaliana] gi|77416510|sp|Q9FZP1.2|HPSE3_ARATH RecName: Full=Heparanase-like protein 3; Flags: Precursor gi|110738426|dbj|BAF01139.1| hypothetical protein [Arabidopsis thaliana] gi|332006540|gb|AED93923.1| Heparanase-like protein 3 [Arabidopsis thaliana] Length = 536 Score = 55.5 bits (132), Expect = 5e-06 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = -2 Query: 440 PVHVNSTEPIEVAPYSIVFVHLPDVVLPAC 351 P+H+NSTEPI +APYSIVFVH+ +VV+PAC Sbjct: 506 PIHINSTEPITIAPYSIVFVHMRNVVVPAC 535 >dbj|BAB10787.1| unnamed protein product [Arabidopsis thaliana] Length = 536 Score = 55.5 bits (132), Expect = 5e-06 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = -2 Query: 440 PVHVNSTEPIEVAPYSIVFVHLPDVVLPAC 351 P+H+NSTEPI +APYSIVFVH+ +VV+PAC Sbjct: 506 PIHINSTEPITIAPYSIVFVHMRNVVVPAC 535 >ref|XP_004159389.1| PREDICTED: LOW QUALITY PROTEIN: heparanase-like protein 3-like [Cucumis sativus] Length = 539 Score = 55.1 bits (131), Expect = 6e-06 Identities = 21/31 (67%), Positives = 29/31 (93%) Frame = -2 Query: 440 PVHVNSTEPIEVAPYSIVFVHLPDVVLPACK 348 P HVNS+EPI VAP+SIVF+H+P+++LPAC+ Sbjct: 509 PQHVNSSEPIMVAPFSIVFIHIPNIILPACR 539