BLASTX nr result
ID: Cnidium21_contig00029382
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00029382 (488 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN76054.1| hypothetical protein VITISV_036406 [Vitis vinifera] 60 2e-07 >emb|CAN76054.1| hypothetical protein VITISV_036406 [Vitis vinifera] Length = 289 Score = 59.7 bits (143), Expect = 2e-07 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -2 Query: 127 MYIGITLRRYKAVKEFGKIKMSVAVVAYYQRMQICQ 20 MYI +TL+RY+AVKE GKIKMSV ++A+YQ MQ+CQ Sbjct: 1 MYIAVTLKRYRAVKEVGKIKMSVGIIAHYQLMQVCQ 36