BLASTX nr result
ID: Cnidium21_contig00029240
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00029240 (359 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004157984.1| PREDICTED: uncharacterized LOC101216010 [Cuc... 56 3e-06 ref|XP_004144318.1| PREDICTED: uncharacterized protein LOC101216... 56 3e-06 >ref|XP_004157984.1| PREDICTED: uncharacterized LOC101216010 [Cucumis sativus] Length = 480 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/60 (45%), Positives = 35/60 (58%), Gaps = 2/60 (3%) Frame = -1 Query: 215 HLADSPGCHNGYRNRSHRKANKQGHIISPAAPPTSAHH--ISPSPQQQVKPPAHHISPSP 42 + A PGC Y+ +S RK KQ H+ A+P S H SPSPQ Q+ PPA +SP+P Sbjct: 386 YTAKPPGCQYRYKRKSGRKEGKQSHLTPLASPNISPDHSAASPSPQHQINPPAAPVSPAP 445 >ref|XP_004144318.1| PREDICTED: uncharacterized protein LOC101216010 [Cucumis sativus] Length = 502 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/60 (45%), Positives = 35/60 (58%), Gaps = 2/60 (3%) Frame = -1 Query: 215 HLADSPGCHNGYRNRSHRKANKQGHIISPAAPPTSAHH--ISPSPQQQVKPPAHHISPSP 42 + A PGC Y+ +S RK KQ H+ A+P S H SPSPQ Q+ PPA +SP+P Sbjct: 386 YTAKPPGCQYRYKRKSGRKEGKQSHLTPLASPNISPDHSAASPSPQHQINPPAAPVSPAP 445