BLASTX nr result
ID: Cnidium21_contig00029214
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00029214 (285 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003571504.1| PREDICTED: uncharacterized protein LOC100843... 85 5e-15 gb|AAZ94630.1| zinc finger protein-like protein [Gossypium hirsu... 81 8e-14 ref|XP_002282524.1| PREDICTED: uncharacterized RNA-binding prote... 81 8e-14 ref|NP_188189.1| Ran BP2/NZF zinc finger-like protein [Arabidops... 80 2e-13 ref|XP_002517589.1| protein with unknown function [Ricinus commu... 80 2e-13 >ref|XP_003571504.1| PREDICTED: uncharacterized protein LOC100843780 isoform 1 [Brachypodium distachyon] Length = 192 Score = 85.1 bits (209), Expect = 5e-15 Identities = 35/44 (79%), Positives = 38/44 (86%) Frame = -3 Query: 280 WKSGDWICTRLGCNEHNFASRMECFRCNAPREPGSRSPY*PRLH 149 WKSGDWICTR GCNEHNFASR+ECFRCNAPR+ GS +PY LH Sbjct: 149 WKSGDWICTRSGCNEHNFASRLECFRCNAPRDSGSATPYENFLH 192 >gb|AAZ94630.1| zinc finger protein-like protein [Gossypium hirsutum] Length = 139 Score = 81.3 bits (199), Expect = 8e-14 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -3 Query: 280 WKSGDWICTRLGCNEHNFASRMECFRCNAPREPGSRSPY 164 WKSGDWICTRLGCNEHNFASRMECFRC+APRE +R+ Y Sbjct: 101 WKSGDWICTRLGCNEHNFASRMECFRCSAPREFNNRTSY 139 >ref|XP_002282524.1| PREDICTED: uncharacterized RNA-binding protein C17H9.04c [Vitis vinifera] gi|296082008|emb|CBI21013.3| unnamed protein product [Vitis vinifera] Length = 158 Score = 81.3 bits (199), Expect = 8e-14 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -3 Query: 280 WKSGDWICTRLGCNEHNFASRMECFRCNAPREPGSRSPY 164 WKSGDWIC R GCNEHNFASRMECFRCNAPR+ G++S Y Sbjct: 118 WKSGDWICNRSGCNEHNFASRMECFRCNAPRDSGNKSSY 156 >ref|NP_188189.1| Ran BP2/NZF zinc finger-like protein [Arabidopsis thaliana] gi|11994340|dbj|BAB02299.1| zinc finger protein-like; Ser/Thr protein kinase-like protein [Arabidopsis thaliana] gi|89274153|gb|ABD65597.1| At3g15680 [Arabidopsis thaliana] gi|332642192|gb|AEE75713.1| Ran BP2/NZF zinc finger-like protein [Arabidopsis thaliana] Length = 164 Score = 80.1 bits (196), Expect = 2e-13 Identities = 31/40 (77%), Positives = 37/40 (92%) Frame = -3 Query: 283 AWKSGDWICTRLGCNEHNFASRMECFRCNAPREPGSRSPY 164 +WKSGDWICTR+GCNEHNFASRMECFRCNAPR+ +R+ + Sbjct: 125 SWKSGDWICTRIGCNEHNFASRMECFRCNAPRDFSNRTSF 164 >ref|XP_002517589.1| protein with unknown function [Ricinus communis] gi|223543221|gb|EEF44753.1| protein with unknown function [Ricinus communis] Length = 152 Score = 80.1 bits (196), Expect = 2e-13 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -3 Query: 280 WKSGDWICTRLGCNEHNFASRMECFRCNAPREPGSRSPY 164 WKSGDWICTR GCNEHNFASRMECF+CNAPRE +R+ Y Sbjct: 114 WKSGDWICTRWGCNEHNFASRMECFKCNAPRELSNRTTY 152