BLASTX nr result
ID: Cnidium21_contig00029117
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00029117 (313 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514629.1| Protein COBRA precursor, putative [Ricinus c... 70 2e-10 ref|XP_004138217.1| PREDICTED: protein COBRA-like [Cucumis sativ... 68 7e-10 ref|XP_003552599.1| PREDICTED: protein COBRA-like [Glycine max] 68 7e-10 emb|CBI16946.3| unnamed protein product [Vitis vinifera] 68 9e-10 ref|XP_002281199.1| PREDICTED: protein COBRA isoform 1 [Vitis vi... 68 9e-10 >ref|XP_002514629.1| Protein COBRA precursor, putative [Ricinus communis] gi|223546233|gb|EEF47735.1| Protein COBRA precursor, putative [Ricinus communis] Length = 383 Score = 69.7 bits (169), Expect = 2e-10 Identities = 31/46 (67%), Positives = 38/46 (82%) Frame = +1 Query: 175 SLPLLTANVILLVLFLSAFTFTSTEAYDPLDPNGNLTIKWDVISWT 312 S+ L+ ILL+ FLS+FTFT +EAYD LDPNGN+TIKWDV+SWT Sbjct: 8 SITKLSTFTILLLFFLSSFTFTPSEAYDALDPNGNITIKWDVMSWT 53 >ref|XP_004138217.1| PREDICTED: protein COBRA-like [Cucumis sativus] gi|449529459|ref|XP_004171717.1| PREDICTED: protein COBRA-like [Cucumis sativus] Length = 455 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = +1 Query: 187 LTANVILLVLFLSAFTFTSTEAYDPLDPNGNLTIKWDVISWT 312 LT +L++ LS+F+FTSTEAYD LDPNGN+TIKWDV+SWT Sbjct: 15 LTVIAVLVLFLLSSFSFTSTEAYDALDPNGNITIKWDVMSWT 56 >ref|XP_003552599.1| PREDICTED: protein COBRA-like [Glycine max] Length = 420 Score = 68.2 bits (165), Expect = 7e-10 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = +1 Query: 178 LPLLTANVILLVLFLSAFTFTSTEAYDPLDPNGNLTIKWDVISWT 312 LP T +++ LVL LS FTST+AYDPLDPNGN+TIKWDVISWT Sbjct: 6 LPKATPSILFLVL-LSCTCFTSTDAYDPLDPNGNITIKWDVISWT 49 >emb|CBI16946.3| unnamed protein product [Vitis vinifera] Length = 436 Score = 67.8 bits (164), Expect = 9e-10 Identities = 33/56 (58%), Positives = 38/56 (67%), Gaps = 4/56 (7%) Frame = +1 Query: 157 MGICL----RSLPLLTANVILLVLFLSAFTFTSTEAYDPLDPNGNLTIKWDVISWT 312 MG CL RS+ ILL+ LS FTSTEAYD LDPNGN+TIKWD++SWT Sbjct: 1 MGFCLSLISRSISSFCGCTILLLFLLSCSCFTSTEAYDALDPNGNITIKWDIMSWT 56 >ref|XP_002281199.1| PREDICTED: protein COBRA isoform 1 [Vitis vinifera] Length = 456 Score = 67.8 bits (164), Expect = 9e-10 Identities = 33/56 (58%), Positives = 38/56 (67%), Gaps = 4/56 (7%) Frame = +1 Query: 157 MGICL----RSLPLLTANVILLVLFLSAFTFTSTEAYDPLDPNGNLTIKWDVISWT 312 MG CL RS+ ILL+ LS FTSTEAYD LDPNGN+TIKWD++SWT Sbjct: 1 MGFCLSLISRSISSFCGCTILLLFLLSCSCFTSTEAYDALDPNGNITIKWDIMSWT 56