BLASTX nr result
ID: Cnidium21_contig00029046
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00029046 (502 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003589440.1| hypothetical protein MTR_1g024370 [Medicago ... 59 4e-07 ref|XP_002521029.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_003589440.1| hypothetical protein MTR_1g024370 [Medicago truncatula] gi|357516789|ref|XP_003628683.1| hypothetical protein MTR_8g063410 [Medicago truncatula] gi|355478488|gb|AES59691.1| hypothetical protein MTR_1g024370 [Medicago truncatula] gi|355522705|gb|AET03159.1| hypothetical protein MTR_8g063410 [Medicago truncatula] Length = 72 Score = 58.9 bits (141), Expect = 4e-07 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = +3 Query: 192 VGMKVKKLQKLIPGGKGSSSNDQLFEMTADYILQLRLQLNVLQAL 326 VG K+KKLQ++IPGG G + DQLF TA++ILQLRLQLN LQAL Sbjct: 23 VGRKMKKLQRIIPGGDGLKA-DQLFLRTAEHILQLRLQLNALQAL 66 >ref|XP_002521029.1| conserved hypothetical protein [Ricinus communis] gi|223539866|gb|EEF41446.1| conserved hypothetical protein [Ricinus communis] Length = 89 Score = 54.7 bits (130), Expect = 8e-06 Identities = 30/51 (58%), Positives = 37/51 (72%) Frame = +3 Query: 192 VGMKVKKLQKLIPGGKGSSSNDQLFEMTADYILQLRLQLNVLQALYNTTST 344 + M+VKKLQ+LIPGG+ D+LF TADYIL L LQ+NVLQAL +T Sbjct: 39 IQMRVKKLQRLIPGGE-ELQPDRLFLRTADYILHLELQVNVLQALSEIYTT 88