BLASTX nr result
ID: Cnidium21_contig00028848
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00028848 (260 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAG51641.1|AC018908_7 putative U2 snRNP auxiliary factor; 190... 65 8e-09 ref|NP_176287.3| Splicing factor U2af large subunit B [Arabidops... 65 8e-09 ref|NP_564764.1| RNA recognition motif-containing protein [Arabi... 65 8e-09 gb|AAM98156.1| putative U2 snRNP auxiliary factor [Arabidopsis t... 65 8e-09 ref|XP_002888120.1| hypothetical protein ARALYDRAFT_475241 [Arab... 64 1e-08 >gb|AAG51641.1|AC018908_7 putative U2 snRNP auxiliary factor; 19096-22891 [Arabidopsis thaliana] Length = 568 Score = 64.7 bits (156), Expect = 8e-09 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -1 Query: 260 DTESASKARTGLHGRKFGGNQVVAVFYEEDKYQQQDYED 144 D + +SKAR+G++GRKFGGNQVVAV+Y EDKY Q DYED Sbjct: 530 DVDGSSKARSGMNGRKFGGNQVVAVYYPEDKYAQGDYED 568 >ref|NP_176287.3| Splicing factor U2af large subunit B [Arabidopsis thaliana] gi|209572798|sp|Q8L716.2|U2A2B_ARATH RecName: Full=Splicing factor U2af large subunit B; AltName: Full=U2 auxiliary factor 65 kDa subunit B; AltName: Full=U2 small nuclear ribonucleoprotein auxiliary factor large subunit B; Short=U2 snRNP auxiliary factor large subunit B gi|332195625|gb|AEE33746.1| Splicing factor U2af large subunit B [Arabidopsis thaliana] Length = 589 Score = 64.7 bits (156), Expect = 8e-09 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -1 Query: 260 DTESASKARTGLHGRKFGGNQVVAVFYEEDKYQQQDYED 144 D + +SKAR+G++GRKFGGNQVVAV+Y EDKY Q DYED Sbjct: 551 DVDGSSKARSGMNGRKFGGNQVVAVYYPEDKYAQGDYED 589 >ref|NP_564764.1| RNA recognition motif-containing protein [Arabidopsis thaliana] gi|12323801|gb|AAG51869.1|AC079675_4 U2 snRNP auxiliary factor, large subunit, putative; 15147-15692 [Arabidopsis thaliana] gi|332195616|gb|AEE33737.1| RNA recognition motif-containing protein [Arabidopsis thaliana] Length = 111 Score = 64.7 bits (156), Expect = 8e-09 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -1 Query: 260 DTESASKARTGLHGRKFGGNQVVAVFYEEDKYQQQDYED 144 D + +SKAR+G++GRKFGGNQVVAV+Y EDKY Q DYED Sbjct: 73 DVDGSSKARSGMNGRKFGGNQVVAVYYPEDKYAQGDYED 111 >gb|AAM98156.1| putative U2 snRNP auxiliary factor [Arabidopsis thaliana] Length = 589 Score = 64.7 bits (156), Expect = 8e-09 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -1 Query: 260 DTESASKARTGLHGRKFGGNQVVAVFYEEDKYQQQDYED 144 D + +SKAR+G++GRKFGGNQVVAV+Y EDKY Q DYED Sbjct: 551 DVDGSSKARSGMNGRKFGGNQVVAVYYPEDKYAQGDYED 589 >ref|XP_002888120.1| hypothetical protein ARALYDRAFT_475241 [Arabidopsis lyrata subsp. lyrata] gi|297333961|gb|EFH64379.1| hypothetical protein ARALYDRAFT_475241 [Arabidopsis lyrata subsp. lyrata] Length = 589 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -1 Query: 260 DTESASKARTGLHGRKFGGNQVVAVFYEEDKYQQQDYED 144 D + +SKAR+G++GRKFGGNQVVAV+Y EDKY Q DYED Sbjct: 551 DVDGSSKARSGMNGRKFGGNQVVAVYYPEDKYLQGDYED 589