BLASTX nr result
ID: Cnidium21_contig00028822
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00028822 (344 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271213.1| PREDICTED: TBC1 domain family member 13 [Vit... 57 1e-06 ref|XP_002518065.1| conserved hypothetical protein [Ricinus comm... 55 6e-06 >ref|XP_002271213.1| PREDICTED: TBC1 domain family member 13 [Vitis vinifera] gi|298205157|emb|CBI17216.3| unnamed protein product [Vitis vinifera] Length = 437 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +1 Query: 1 TSNLKLLQNYPSTNISHLLYVANKLRSHPVG 93 TSNLKLLQNYPSTNISHLLYVANKLR+ G Sbjct: 407 TSNLKLLQNYPSTNISHLLYVANKLRAQSTG 437 >ref|XP_002518065.1| conserved hypothetical protein [Ricinus communis] gi|223542661|gb|EEF44198.1| conserved hypothetical protein [Ricinus communis] Length = 468 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +1 Query: 1 TSNLKLLQNYPSTNISHLLYVANKLRSHP 87 TSNLKLLQNYP TNISHLLYVANKLR P Sbjct: 438 TSNLKLLQNYPPTNISHLLYVANKLRVQP 466