BLASTX nr result
ID: Cnidium21_contig00028757
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00028757 (242 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003626683.1| CCR4-NOT transcription complex subunit [Medi... 57 2e-06 ref|XP_003626682.1| CCR4-NOT transcription complex subunit [Medi... 57 2e-06 >ref|XP_003626683.1| CCR4-NOT transcription complex subunit [Medicago truncatula] gi|355520705|gb|AET01159.1| CCR4-NOT transcription complex subunit [Medicago truncatula] Length = 2410 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = -3 Query: 129 KLAERPGSPESLRQLAEIARNPAALSDPTVGREDNLRHSRDRK 1 KLA +PG PESL+QL E+ +NPAALS VG+ED +R SRD K Sbjct: 1810 KLATKPGYPESLQQLLEMIKNPAALSASNVGKEDKVRQSRDNK 1852 >ref|XP_003626682.1| CCR4-NOT transcription complex subunit [Medicago truncatula] gi|355520704|gb|AET01158.1| CCR4-NOT transcription complex subunit [Medicago truncatula] Length = 2418 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = -3 Query: 129 KLAERPGSPESLRQLAEIARNPAALSDPTVGREDNLRHSRDRK 1 KLA +PG PESL+QL E+ +NPAALS VG+ED +R SRD K Sbjct: 1810 KLATKPGYPESLQQLLEMIKNPAALSASNVGKEDKVRQSRDNK 1852