BLASTX nr result
ID: Cnidium21_contig00028697
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00028697 (280 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528200.1| regulator of telomere elongation helicase 1 ... 113 1e-23 ref|XP_002279773.2| PREDICTED: regulator of telomere elongation ... 110 9e-23 ref|XP_003542103.1| PREDICTED: regulator of telomere elongation ... 103 1e-20 ref|XP_004141849.1| PREDICTED: regulator of telomere elongation ... 103 2e-20 ref|XP_003597782.1| Regulator of telomere elongation helicase [M... 103 2e-20 >ref|XP_002528200.1| regulator of telomere elongation helicase 1 rtel1, putative [Ricinus communis] gi|223532412|gb|EEF34207.1| regulator of telomere elongation helicase 1 rtel1, putative [Ricinus communis] Length = 1049 Score = 113 bits (283), Expect = 1e-23 Identities = 56/76 (73%), Positives = 63/76 (82%) Frame = +3 Query: 3 KKGSNFLSQVKEKLTDAEYKDFVGFMRALKSKAEKASHVLQSIAKLFSAPDRLPLLQRFK 182 K+GS FL QVKEKLT AEYK+FVGFM+ALKSKA + VL+SI KLFS PDR PLL+RFK Sbjct: 932 KRGSAFLIQVKEKLTAAEYKEFVGFMKALKSKAMQIGSVLESIVKLFSGPDRFPLLKRFK 991 Query: 183 DYVPAKYQHLYELYLE 230 DY+PAKY LYE YLE Sbjct: 992 DYIPAKYHSLYEHYLE 1007 >ref|XP_002279773.2| PREDICTED: regulator of telomere elongation helicase 1-like [Vitis vinifera] Length = 1084 Score = 110 bits (276), Expect = 9e-23 Identities = 53/75 (70%), Positives = 65/75 (86%) Frame = +3 Query: 6 KGSNFLSQVKEKLTDAEYKDFVGFMRALKSKAEKASHVLQSIAKLFSAPDRLPLLQRFKD 185 +GS FL QV+EKL+ AEYK+FVGFM+ALKSKA K VL+SIA+LFS P+RLPLL+RFKD Sbjct: 971 RGSAFLIQVQEKLSTAEYKEFVGFMKALKSKAMKIGQVLESIARLFSGPERLPLLKRFKD 1030 Query: 186 YVPAKYQHLYELYLE 230 Y+PAKYQ LY+ YL+ Sbjct: 1031 YIPAKYQSLYQQYLK 1045 >ref|XP_003542103.1| PREDICTED: regulator of telomere elongation helicase 1-like [Glycine max] Length = 1001 Score = 103 bits (258), Expect = 1e-20 Identities = 49/75 (65%), Positives = 63/75 (84%) Frame = +3 Query: 6 KGSNFLSQVKEKLTDAEYKDFVGFMRALKSKAEKASHVLQSIAKLFSAPDRLPLLQRFKD 185 KGS FL+QV++KL+ AEY +FVG+M+ALK+K K S VLQ I++LF+ PDRLPLL+RFKD Sbjct: 925 KGSAFLAQVRDKLSAAEYINFVGYMKALKTKTMKISEVLQCISRLFTGPDRLPLLKRFKD 984 Query: 186 YVPAKYQHLYELYLE 230 Y+PAKY LYE Y+E Sbjct: 985 YIPAKYHSLYEHYVE 999 >ref|XP_004141849.1| PREDICTED: regulator of telomere elongation helicase 1-like [Cucumis sativus] Length = 1054 Score = 103 bits (256), Expect = 2e-20 Identities = 50/74 (67%), Positives = 60/74 (81%) Frame = +3 Query: 6 KGSNFLSQVKEKLTDAEYKDFVGFMRALKSKAEKASHVLQSIAKLFSAPDRLPLLQRFKD 185 KGS+FLSQV+EKL+D EYK+FVGFM+ALK+KA +HVLQSI ++FS PDRL L FKD Sbjct: 977 KGSDFLSQVREKLSDREYKEFVGFMKALKTKAMGITHVLQSIVRIFSGPDRLRLRTGFKD 1036 Query: 186 YVPAKYQHLYELYL 227 Y+PAKY LYE L Sbjct: 1037 YIPAKYHFLYEQLL 1050 >ref|XP_003597782.1| Regulator of telomere elongation helicase [Medicago truncatula] gi|355486830|gb|AES68033.1| Regulator of telomere elongation helicase [Medicago truncatula] Length = 1089 Score = 103 bits (256), Expect = 2e-20 Identities = 49/75 (65%), Positives = 63/75 (84%) Frame = +3 Query: 6 KGSNFLSQVKEKLTDAEYKDFVGFMRALKSKAEKASHVLQSIAKLFSAPDRLPLLQRFKD 185 +GS FL+QV++KL+ AEY DFVG+M+ALK+K K S VL SI++LFS P+RLPLL+RFKD Sbjct: 994 QGSAFLAQVRDKLSAAEYIDFVGYMKALKTKTLKISEVLLSISRLFSGPERLPLLKRFKD 1053 Query: 186 YVPAKYQHLYELYLE 230 Y+PAKY LYE Y+E Sbjct: 1054 YIPAKYHSLYEQYVE 1068