BLASTX nr result
ID: Cnidium21_contig00028693
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00028693 (341 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABN10954.2| APETALA2-like protein [Ipomoea nil] 58 9e-07 >gb|ABN10954.2| APETALA2-like protein [Ipomoea nil] Length = 451 Score = 57.8 bits (138), Expect = 9e-07 Identities = 35/88 (39%), Positives = 45/88 (51%), Gaps = 5/88 (5%) Frame = +3 Query: 30 NKNQESADTHHNLDLSLWISPPSNSQKGNNSVRSLCLNDVASHLSTVKRTKVE-----RF 194 NKN T+ +LDL+LWISPP + K + R L N A LS +KR KVE + Sbjct: 298 NKNTRDGGTNASLDLNLWISPPLDGPKRPENARKLQFNFEARDLSLLKRVKVECTPGTPY 357 Query: 195 APALAGRETPYYLPSWPGNHPGLAPNYE 278 PA+A + + WPG L PN E Sbjct: 358 GPAMASQYS-----RWPGLQSALTPNNE 380