BLASTX nr result
ID: Cnidium21_contig00028685
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00028685 (556 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003593577.1| hypothetical protein MTR_2g013690 [Medicago ... 65 6e-09 ref|XP_002305132.1| predicted protein [Populus trichocarpa] gi|2... 64 2e-08 ref|XP_003545980.1| PREDICTED: uncharacterized protein LOC100792... 61 1e-07 ref|XP_002509470.1| conserved hypothetical protein [Ricinus comm... 61 1e-07 ref|XP_003543045.1| PREDICTED: uncharacterized protein LOC100804... 60 2e-07 >ref|XP_003593577.1| hypothetical protein MTR_2g013690 [Medicago truncatula] gi|355482625|gb|AES63828.1| hypothetical protein MTR_2g013690 [Medicago truncatula] Length = 570 Score = 65.5 bits (158), Expect = 6e-09 Identities = 29/45 (64%), Positives = 32/45 (71%) Frame = -3 Query: 158 DRQSMIV*APSPPKYFTRYTLPPGNSCESFTLSPPPAHKKRTGPR 24 D + +V PSPP YF Y LPPG+ C SFTL PPPA KKRTGPR Sbjct: 112 DLATNLVLPPSPPSYFLGYNLPPGHPCNSFTLPPPPADKKRTGPR 156 >ref|XP_002305132.1| predicted protein [Populus trichocarpa] gi|222848096|gb|EEE85643.1| predicted protein [Populus trichocarpa] Length = 591 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = -3 Query: 131 PSPPKYFTRYTLPPGNSCESFTLSPPPAHKKRTGPR 24 P PP YF YTLPPG+ C SFTL PPPA KKRTGPR Sbjct: 132 PPPPAYFLGYTLPPGHPCNSFTLPPPPADKKRTGPR 167 >ref|XP_003545980.1| PREDICTED: uncharacterized protein LOC100792761 [Glycine max] Length = 570 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = -3 Query: 131 PSPPKYFTRYTLPPGNSCESFTLSPPPAHKKRTGPR 24 P PP YF YTLP G+ C SFTL PPPA KKRTGPR Sbjct: 125 PPPPSYFLGYTLPSGHPCNSFTLPPPPADKKRTGPR 160 >ref|XP_002509470.1| conserved hypothetical protein [Ricinus communis] gi|223549369|gb|EEF50857.1| conserved hypothetical protein [Ricinus communis] Length = 587 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = -3 Query: 131 PSPPKYFTRYTLPPGNSCESFTLSPPPAHKKRTGPR 24 P P YF YTLPPG+ C SFTL PPPA KKRTGPR Sbjct: 136 PPPTPYFLGYTLPPGHPCNSFTLPPPPADKKRTGPR 171 >ref|XP_003543045.1| PREDICTED: uncharacterized protein LOC100804922 [Glycine max] Length = 570 Score = 60.1 bits (144), Expect = 2e-07 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = -3 Query: 131 PSPPKYFTRYTLPPGNSCESFTLSPPPAHKKRTGPR 24 P PP YF YTLP G+ C +FTL PPPA KKRTGPR Sbjct: 125 PPPPSYFLGYTLPSGHPCNTFTLPPPPADKKRTGPR 160