BLASTX nr result
ID: Cnidium21_contig00028679
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00028679 (391 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA82995.1| cysteine proteinase [Vicia sativa] 73 2e-11 ref|XP_002306900.1| predicted protein [Populus trichocarpa] gi|1... 73 3e-11 gb|ACM80348.1| cysteine proteinase [Solanum lycopersicum] 72 5e-11 gb|ACK57563.1| cysteine protease-like protein [Arachis hypogaea] 71 1e-10 gb|AAO11786.1| pre-pro cysteine proteinase [Vicia faba] 70 2e-10 >emb|CAA82995.1| cysteine proteinase [Vicia sativa] Length = 358 Score = 73.2 bits (178), Expect = 2e-11 Identities = 36/55 (65%), Positives = 45/55 (81%), Gaps = 4/55 (7%) Frame = +2 Query: 239 ASLDDILIRQVV--EDDHV--ADHHFSIFKNKFGKSYESKEEHEYRFSVFKANLL 391 A+ DD LIRQVV E+DH+ A+HHF+ FK+KF KSY +KEEH+YRF VFKANL+ Sbjct: 18 AATDDFLIRQVVDNEEDHLLNAEHHFTSFKSKFSKSYATKEEHDYRFGVFKANLI 72 >ref|XP_002306900.1| predicted protein [Populus trichocarpa] gi|118481986|gb|ABK92924.1| unknown [Populus trichocarpa] gi|222856349|gb|EEE93896.1| predicted protein [Populus trichocarpa] Length = 367 Score = 72.8 bits (177), Expect = 3e-11 Identities = 36/55 (65%), Positives = 46/55 (83%), Gaps = 4/55 (7%) Frame = +2 Query: 239 ASLDDILIRQVVED--DHV--ADHHFSIFKNKFGKSYESKEEHEYRFSVFKANLL 391 + LDD LIRQVV + DH+ A+HHF+ FK+KFGK+Y ++EEH+YRFSVFKANLL Sbjct: 26 SDLDDPLIRQVVSEGEDHLLNAEHHFTTFKSKFGKNYATQEEHDYRFSVFKANLL 80 >gb|ACM80348.1| cysteine proteinase [Solanum lycopersicum] Length = 368 Score = 72.0 bits (175), Expect = 5e-11 Identities = 36/51 (70%), Positives = 42/51 (82%), Gaps = 4/51 (7%) Frame = +2 Query: 248 DDILIRQVV--EDDHV--ADHHFSIFKNKFGKSYESKEEHEYRFSVFKANL 388 DDILIRQVV ED H+ A+HHF++FK +FGK+Y S EEH YRFSVFKANL Sbjct: 32 DDILIRQVVGDEDHHMLNAEHHFTLFKKRFGKTYASDEEHHYRFSVFKANL 82 >gb|ACK57563.1| cysteine protease-like protein [Arachis hypogaea] Length = 364 Score = 70.9 bits (172), Expect = 1e-10 Identities = 35/52 (67%), Positives = 43/52 (82%), Gaps = 4/52 (7%) Frame = +2 Query: 248 DDILIRQVVED--DHV--ADHHFSIFKNKFGKSYESKEEHEYRFSVFKANLL 391 D+ILIRQVVED +H+ A+HHFS FK KF K+Y +KEEH+YRF VFK+NLL Sbjct: 27 DNILIRQVVEDGDEHLLNAEHHFSAFKTKFSKTYATKEEHDYRFGVFKSNLL 78 >gb|AAO11786.1| pre-pro cysteine proteinase [Vicia faba] Length = 363 Score = 70.1 bits (170), Expect = 2e-10 Identities = 33/52 (63%), Positives = 43/52 (82%), Gaps = 4/52 (7%) Frame = +2 Query: 248 DDILIRQVV--EDDHV--ADHHFSIFKNKFGKSYESKEEHEYRFSVFKANLL 391 DD +IRQVV E+DH+ A+HHF+ FK+KF KSY +KEEH+YRF VFK+NL+ Sbjct: 26 DDFIIRQVVDNEEDHLLNAEHHFTSFKSKFSKSYSTKEEHDYRFGVFKSNLI 77