BLASTX nr result
ID: Cnidium21_contig00028324
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00028324 (420 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533815.1| conserved hypothetical protein [Ricinus comm... 64 2e-08 emb|CAN79607.1| hypothetical protein VITISV_027501 [Vitis vinifera] 57 1e-06 >ref|XP_002533815.1| conserved hypothetical protein [Ricinus communis] gi|223526252|gb|EEF28568.1| conserved hypothetical protein [Ricinus communis] Length = 165 Score = 63.5 bits (153), Expect = 2e-08 Identities = 39/97 (40%), Positives = 52/97 (53%), Gaps = 3/97 (3%) Frame = -2 Query: 302 MKKTRLYPRYGTED---SHDFDPQLDFAMFLKEARNYEYKVNNTKVDQLPSLEDVMQSDE 132 MKK+ +YP + T D +FDPQ+DF FL+EAR + ++N E ++ E Sbjct: 1 MKKSPVYPNFETSDYEGGFEFDPQVDFTQFLEEARQHAREMNFQTASAQQPEEAGKRTGE 60 Query: 131 GLKSKKSWKNSFLFSWFKAAKKVNKPSLMETEPSEKS 21 KSKKSW+ S LF W+KA NK S EP S Sbjct: 61 EKKSKKSWRTS-LFKWWKAD---NKKSEASKEPENSS 93 >emb|CAN79607.1| hypothetical protein VITISV_027501 [Vitis vinifera] Length = 1694 Score = 57.4 bits (137), Expect = 1e-06 Identities = 40/98 (40%), Positives = 55/98 (56%), Gaps = 2/98 (2%) Frame = -2 Query: 335 HTSFLCVVEARMKKTRLYPRYGTED--SHDFDPQLDFAMFLKEARNYEYKVNNTKVDQLP 162 H + L ++ A+M K+ +YP+ T D H D Q DF+ FL+EAR + + N Sbjct: 1591 HPNALAII-AKMLKSAVYPKCETGDYNDHGLDLQEDFSQFLEEARRHARQGNPQGPSPHG 1649 Query: 161 SLEDVMQSDEGLKSKKSWKNSFLFSWFKAAKKVNKPSL 48 + E +SKKSWK S LFSW+KA KK NKPS+ Sbjct: 1650 DEAGKGRLSEEKRSKKSWK-STLFSWWKADKK-NKPSV 1685