BLASTX nr result
ID: Cnidium21_contig00028085
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00028085 (618 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514949.1| OTU domain-containing protein 6B, putative [... 71 4e-14 ref|XP_003552786.1| PREDICTED: LOW QUALITY PROTEIN: OTU domain-c... 65 1e-08 ref|XP_004136582.1| PREDICTED: OTU domain-containing protein At3... 64 3e-08 ref|XP_003632695.1| PREDICTED: OTU domain-containing protein At3... 64 3e-08 ref|XP_003537539.1| PREDICTED: OTU domain-containing protein At3... 64 3e-08 >ref|XP_002514949.1| OTU domain-containing protein 6B, putative [Ricinus communis] gi|223546000|gb|EEF47503.1| OTU domain-containing protein 6B, putative [Ricinus communis] Length = 167 Score = 70.9 bits (172), Expect(2) = 4e-14 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = +2 Query: 407 FDQFIHGACLRTGKPSPTKCLEKELADELRANVVNEFIKRRADSE 541 F +HGACLR GKPSPT+ LEKELADELRA V +EFIKRR D+E Sbjct: 34 FRSVVHGACLREGKPSPTESLEKELADELRAKVADEFIKRRRDTE 78 Score = 32.3 bits (72), Expect(2) = 4e-14 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 379 GIPGDGRCLFRSV 417 GIPGDGRCLFRSV Sbjct: 25 GIPGDGRCLFRSV 37 >ref|XP_003552786.1| PREDICTED: LOW QUALITY PROTEIN: OTU domain-containing protein At3g57810-like [Glycine max] Length = 158 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = +2 Query: 407 FDQFIHGACLRTGKPSPTKCLEKELADELRANVVNEFIKRRADSE 541 F ++GACLR+G+PSP+ +KELADELRA VV+EFIKRRAD+E Sbjct: 29 FRSVVYGACLRSGEPSPSLSRQKELADELRAKVVDEFIKRRADTE 73 >ref|XP_004136582.1| PREDICTED: OTU domain-containing protein At3g57810-like [Cucumis sativus] gi|449522883|ref|XP_004168455.1| PREDICTED: OTU domain-containing protein At3g57810-like [Cucumis sativus] Length = 286 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/45 (60%), Positives = 38/45 (84%) Frame = +2 Query: 407 FDQFIHGACLRTGKPSPTKCLEKELADELRANVVNEFIKRRADSE 541 F HGACLR+GKP+P++ L+++LADELR+NV +EFIKRR ++E Sbjct: 151 FRSVAHGACLRSGKPAPSESLQRDLADELRSNVADEFIKRREETE 195 >ref|XP_003632695.1| PREDICTED: OTU domain-containing protein At3g57810-like [Vitis vinifera] Length = 340 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/45 (60%), Positives = 38/45 (84%) Frame = +2 Query: 407 FDQFIHGACLRTGKPSPTKCLEKELADELRANVVNEFIKRRADSE 541 F +HGACLR+GKP+P+ ++ELADELRA VV+EFI+RR+++E Sbjct: 206 FRSVVHGACLRSGKPAPSASCQRELADELRAEVVDEFIRRRSETE 250 >ref|XP_003537539.1| PREDICTED: OTU domain-containing protein At3g57810-like [Glycine max] Length = 156 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = +2 Query: 407 FDQFIHGACLRTGKPSPTKCLEKELADELRANVVNEFIKRRADSE 541 F ++GACLR+G+PSP+ +KELADELRA VV+EFIKRR D+E Sbjct: 28 FRSVVYGACLRSGEPSPSLSRQKELADELRAKVVDEFIKRRVDTE 72