BLASTX nr result
ID: Cnidium21_contig00027813
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00027813 (445 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003601050.1| F-box/kelch-repeat protein [Medicago truncat... 61 1e-07 gb|AFK44336.1| unknown [Lotus japonicus] 57 2e-06 ref|XP_003621771.1| F-box family protein [Medicago truncatula] g... 57 2e-06 ref|XP_002520393.1| ubiquitin-protein ligase, putative [Ricinus ... 56 3e-06 ref|XP_003611186.1| F-box/kelch-repeat protein [Medicago truncat... 56 4e-06 >ref|XP_003601050.1| F-box/kelch-repeat protein [Medicago truncatula] gi|355490098|gb|AES71301.1| F-box/kelch-repeat protein [Medicago truncatula] Length = 415 Score = 60.8 bits (146), Expect = 1e-07 Identities = 30/48 (62%), Positives = 36/48 (75%) Frame = +3 Query: 291 DELIKTEILSRLPVKSIVRCRCVCKSWKHLLSSDPGFVKSHLTRYSEN 434 DELI EILSRLPVK++++ +CVCKSWK L+S DP F K HL R N Sbjct: 21 DELI-VEILSRLPVKTLMQFKCVCKSWKTLISDDPVFAKFHLHRSPRN 67 >gb|AFK44336.1| unknown [Lotus japonicus] Length = 193 Score = 56.6 bits (135), Expect = 2e-06 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +3 Query: 291 DELIKTEILSRLPVKSIVRCRCVCKSWKHLLSSDPGFVKSHL 416 DEL+ EILSRLPVKS+++ RCVCKSW LL SDP F+K HL Sbjct: 65 DELV-VEILSRLPVKSLLKFRCVCKSWM-LLISDPYFIKKHL 104 >ref|XP_003621771.1| F-box family protein [Medicago truncatula] gi|355496786|gb|AES77989.1| F-box family protein [Medicago truncatula] Length = 524 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/47 (53%), Positives = 35/47 (74%) Frame = +3 Query: 300 IKTEILSRLPVKSIVRCRCVCKSWKHLLSSDPGFVKSHLTRYSENLN 440 + EILSRLPV+S+++ +CVCKSW ++ SDP F+K HL R + N N Sbjct: 98 VMAEILSRLPVRSLMQIKCVCKSWNTII-SDPKFIKMHLNRSARNPN 143 >ref|XP_002520393.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223540440|gb|EEF42009.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 369 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/44 (52%), Positives = 34/44 (77%) Frame = +3 Query: 309 EILSRLPVKSIVRCRCVCKSWKHLLSSDPGFVKSHLTRYSENLN 440 +ILSRLPVK +++ +CVC++W++L+SSDP F K HL R + N Sbjct: 15 DILSRLPVKHLIQFKCVCRTWQYLISSDPEFAKLHLERVLQVTN 58 >ref|XP_003611186.1| F-box/kelch-repeat protein [Medicago truncatula] gi|355512521|gb|AES94144.1| F-box/kelch-repeat protein [Medicago truncatula] Length = 375 Score = 55.8 bits (133), Expect = 4e-06 Identities = 23/39 (58%), Positives = 29/39 (74%) Frame = +3 Query: 300 IKTEILSRLPVKSIVRCRCVCKSWKHLLSSDPGFVKSHL 416 + EI+SRLPVK ++R RCVC SW L+S+DP F K HL Sbjct: 21 LAAEIISRLPVKCVLRFRCVCNSWNSLISTDPKFAKKHL 59