BLASTX nr result
ID: Cnidium21_contig00027722
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00027722 (453 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003613390.1| PttB [Medicago truncatula] gi|355514725|gb|A... 42 5e-06 >ref|XP_003613390.1| PttB [Medicago truncatula] gi|355514725|gb|AES96348.1| PttB [Medicago truncatula] Length = 1083 Score = 42.4 bits (98), Expect(2) = 5e-06 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Frame = -3 Query: 415 PTSAITWASTPLAHKDAVWAEFMKRYRWADEQGPMISTLLWQK-CAVRTKDNLNKERDKA 239 PT+A W P+ KD ++ EFM +Y +A + I+ ++W + C R D+L R A Sbjct: 793 PTAAAKWKDYPIEMKDELFREFMGKYNFASDSERNIARIVWNRTCMDRYPDHLKNARKTA 852 Query: 238 I 236 + Sbjct: 853 L 853 Score = 32.7 bits (73), Expect(2) = 5e-06 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = -1 Query: 165 DIWDAMCDQWRSEGWVKKRGIAAGNRCAGVPSGEKAKGTYKGGSISQKQH 16 ++W+ + D W W KK + NRC + A T GGSIS ++H Sbjct: 875 EVWNGLVDIWLKPEWTKK---SDANRCNRAAKPDSALHT--GGSISFREH 919