BLASTX nr result
ID: Cnidium21_contig00027715
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00027715 (274 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001235041.1| uncharacterized protein LOC100305670 [Glycin... 84 2e-14 ref|XP_002526766.1| Thylakoid lumenal 19 kDa protein, chloroplas... 84 2e-14 ref|XP_003546881.1| PREDICTED: thylakoid lumenal 19 kDa protein,... 83 2e-14 ref|XP_004158197.1| PREDICTED: thylakoid lumenal 19 kDa protein,... 80 1e-13 ref|XP_004135924.1| PREDICTED: thylakoid lumenal 19 kDa protein,... 80 1e-13 >ref|NP_001235041.1| uncharacterized protein LOC100305670 [Glycine max] gi|255626267|gb|ACU13478.1| unknown [Glycine max] Length = 246 Score = 83.6 bits (205), Expect = 2e-14 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -3 Query: 272 ISVTCARNKLYAHFVNAPTPEWNKDKETLRHVHESFKTIG 153 ISVTCA+NKLYAHFVNAPTPEWN+DK+ LRHVHESFKT+G Sbjct: 205 ISVTCAKNKLYAHFVNAPTPEWNRDKDVLRHVHESFKTVG 244 >ref|XP_002526766.1| Thylakoid lumenal 19 kDa protein, chloroplast precursor, putative [Ricinus communis] gi|223533893|gb|EEF35620.1| Thylakoid lumenal 19 kDa protein, chloroplast precursor, putative [Ricinus communis] Length = 240 Score = 83.6 bits (205), Expect = 2e-14 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -3 Query: 272 ISVTCARNKLYAHFVNAPTPEWNKDKETLRHVHESFKTIG 153 I VTCA+NKLYAHFVNAPTPEWNKD+ETLRH+HESFKT+G Sbjct: 199 IKVTCAKNKLYAHFVNAPTPEWNKDEETLRHLHESFKTVG 238 >ref|XP_003546881.1| PREDICTED: thylakoid lumenal 19 kDa protein, chloroplastic-like [Glycine max] Length = 240 Score = 83.2 bits (204), Expect = 2e-14 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -3 Query: 272 ISVTCARNKLYAHFVNAPTPEWNKDKETLRHVHESFKTIG 153 ISVTCA+NKLYAHFVNAPTPEWN+DK+ LRHVHESFKT+G Sbjct: 199 ISVTCAKNKLYAHFVNAPTPEWNRDKDMLRHVHESFKTVG 238 >ref|XP_004158197.1| PREDICTED: thylakoid lumenal 19 kDa protein, chloroplastic-like [Cucumis sativus] Length = 250 Score = 80.5 bits (197), Expect = 1e-13 Identities = 33/40 (82%), Positives = 39/40 (97%) Frame = -3 Query: 272 ISVTCARNKLYAHFVNAPTPEWNKDKETLRHVHESFKTIG 153 ISVTCA+NKLYAHFVNAPTPEWN+D++ LRHVH+SFKT+G Sbjct: 209 ISVTCAKNKLYAHFVNAPTPEWNRDQDMLRHVHDSFKTVG 248 >ref|XP_004135924.1| PREDICTED: thylakoid lumenal 19 kDa protein, chloroplastic-like [Cucumis sativus] Length = 245 Score = 80.5 bits (197), Expect = 1e-13 Identities = 33/40 (82%), Positives = 39/40 (97%) Frame = -3 Query: 272 ISVTCARNKLYAHFVNAPTPEWNKDKETLRHVHESFKTIG 153 ISVTCA+NKLYAHFVNAPTPEWN+D++ LRHVH+SFKT+G Sbjct: 204 ISVTCAKNKLYAHFVNAPTPEWNRDQDMLRHVHDSFKTVG 243