BLASTX nr result
ID: Cnidium21_contig00027385
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00027385 (369 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281385.1| PREDICTED: uncharacterized protein LOC100241... 91 8e-17 ref|XP_002509639.1| conserved hypothetical protein [Ricinus comm... 80 1e-13 ref|XP_002279860.1| PREDICTED: uncharacterized protein LOC100257... 71 8e-11 ref|XP_002320732.1| predicted protein [Populus trichocarpa] gi|2... 71 1e-10 ref|XP_002303541.1| predicted protein [Populus trichocarpa] gi|2... 66 3e-09 >ref|XP_002281385.1| PREDICTED: uncharacterized protein LOC100241009 [Vitis vinifera] gi|297742657|emb|CBI34806.3| unnamed protein product [Vitis vinifera] Length = 99 Score = 91.3 bits (225), Expect = 8e-17 Identities = 45/68 (66%), Positives = 53/68 (77%) Frame = +1 Query: 154 RLKRYRIQVHRLNRRKRSEENIGDDMKEKNLKLYMENITIFHENEKLRMKASLLHQENLS 333 R KR ++QVHRL RR+R E + DM+ KNLKLY+EN I ENEKLR KA+LLHQENL+ Sbjct: 14 RTKRSKVQVHRLTRRRRCEVQVEKDMELKNLKLYLENRNIMEENEKLRKKATLLHQENLA 73 Query: 334 LMSEFQKK 357 LMSEFQ K Sbjct: 74 LMSEFQTK 81 >ref|XP_002509639.1| conserved hypothetical protein [Ricinus communis] gi|223549538|gb|EEF51026.1| conserved hypothetical protein [Ricinus communis] Length = 108 Score = 80.5 bits (197), Expect = 1e-13 Identities = 43/68 (63%), Positives = 53/68 (77%) Frame = +1 Query: 154 RLKRYRIQVHRLNRRKRSEENIGDDMKEKNLKLYMENITIFHENEKLRMKASLLHQENLS 333 R K+ ++QV L RR+ EE G DM+ KNLKLY+EN +I ENEKLR KA+LLHQENL+ Sbjct: 22 RSKKPKVQVLGLTRRRCQEEE-GKDMELKNLKLYLENQSIVEENEKLRKKANLLHQENLA 80 Query: 334 LMSEFQKK 357 L+SEFQKK Sbjct: 81 LISEFQKK 88 >ref|XP_002279860.1| PREDICTED: uncharacterized protein LOC100257531 [Vitis vinifera] gi|296089165|emb|CBI38868.3| unnamed protein product [Vitis vinifera] Length = 111 Score = 71.2 bits (173), Expect = 8e-11 Identities = 41/80 (51%), Positives = 52/80 (65%), Gaps = 12/80 (15%) Frame = +1 Query: 154 RLKRYRIQVHRLNR------RKRSEEN------IGDDMKEKNLKLYMENITIFHENEKLR 297 RLKR+ +QV RLNR RK S++ + +M+ KN KLYM N +I ENEKLR Sbjct: 22 RLKRFNVQVRRLNRMRSRRTRKESKDKAMMVVGVKSEMEIKNWKLYMLNQSIIQENEKLR 81 Query: 298 MKASLLHQENLSLMSEFQKK 357 MKA LLHQEN +L+S+ Q K Sbjct: 82 MKALLLHQENQALLSQLQNK 101 >ref|XP_002320732.1| predicted protein [Populus trichocarpa] gi|222861505|gb|EEE99047.1| predicted protein [Populus trichocarpa] Length = 112 Score = 70.9 bits (172), Expect = 1e-10 Identities = 37/74 (50%), Positives = 50/74 (67%), Gaps = 7/74 (9%) Frame = +1 Query: 160 KRYRIQVHRLNRRKRSEEN-------IGDDMKEKNLKLYMENITIFHENEKLRMKASLLH 318 K + ++ HRLNRR+R + + +M+ KNLKLYMEN +I ENEKLR KA LLH Sbjct: 26 KGHNLRYHRLNRRRRLSKGKRVALVLVKKEMEIKNLKLYMENKSIIEENEKLRKKAFLLH 85 Query: 319 QENLSLMSEFQKKK 360 QEN +L+ + QKK+ Sbjct: 86 QENQALLYQLQKKR 99 >ref|XP_002303541.1| predicted protein [Populus trichocarpa] gi|222840973|gb|EEE78520.1| predicted protein [Populus trichocarpa] Length = 60 Score = 66.2 bits (160), Expect = 3e-09 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = +1 Query: 229 MKEKNLKLYMENITIFHENEKLRMKASLLHQENLSLMSEFQKK 357 M+ KNLKLY+EN +I ENEKLR KASLLHQENL+LMSE QKK Sbjct: 1 MELKNLKLYLENQSIVEENEKLRKKASLLHQENLALMSELQKK 43