BLASTX nr result
ID: Cnidium21_contig00027259
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00027259 (294 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003571073.1| PREDICTED: MLO-like protein 1-like [Brachypo... 47 2e-07 >ref|XP_003571073.1| PREDICTED: MLO-like protein 1-like [Brachypodium distachyon] Length = 496 Score = 46.6 bits (109), Expect(2) = 2e-07 Identities = 19/33 (57%), Positives = 24/33 (72%) Frame = +1 Query: 193 TYY*EHCPSTPKFNFHTYMLRTLEHDFKHMVGI 291 T+ H P+ P F+FH YM+R LEHDFK +VGI Sbjct: 208 TFVQRHYPNRPDFDFHKYMVRALEHDFKEVVGI 240 Score = 33.5 bits (75), Expect(2) = 2e-07 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = +2 Query: 17 FKQFYGSVTKSDYIALRAVFIQ 82 FKQFY SV K DY LRA F+Q Sbjct: 190 FKQFYDSVGKPDYQVLRATFVQ 211