BLASTX nr result
ID: Cnidium21_contig00027234
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00027234 (316 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004140742.1| PREDICTED: uncharacterized protein LOC101208... 114 8e-24 ref|XP_002301718.1| predicted protein [Populus trichocarpa] gi|2... 112 4e-23 ref|XP_002271418.1| PREDICTED: uncharacterized protein LOC100248... 112 4e-23 dbj|BAJ95193.1| predicted protein [Hordeum vulgare subsp. vulgare] 111 7e-23 ref|XP_002532639.1| conserved hypothetical protein [Ricinus comm... 111 7e-23 >ref|XP_004140742.1| PREDICTED: uncharacterized protein LOC101208221 [Cucumis sativus] gi|449518314|ref|XP_004166187.1| PREDICTED: uncharacterized LOC101208221 [Cucumis sativus] Length = 137 Score = 114 bits (285), Expect = 8e-24 Identities = 46/52 (88%), Positives = 50/52 (96%) Frame = -3 Query: 314 HTAHFGGETKRKFESVHSGGTMSTPDAGKISQYWHCCGSEDPFDPGCTAAPH 159 HT+HFGGETKRKFESVHSGGTM TPD+GK+ QYWHCCGSEDPFDPGCTA+PH Sbjct: 80 HTSHFGGETKRKFESVHSGGTMDTPDSGKVFQYWHCCGSEDPFDPGCTASPH 131 >ref|XP_002301718.1| predicted protein [Populus trichocarpa] gi|222843444|gb|EEE80991.1| predicted protein [Populus trichocarpa] Length = 131 Score = 112 bits (279), Expect = 4e-23 Identities = 45/52 (86%), Positives = 51/52 (98%) Frame = -3 Query: 314 HTAHFGGETKRKFESVHSGGTMSTPDAGKISQYWHCCGSEDPFDPGCTAAPH 159 HT+HFGGETKRKFESV++GGTMSTPD+G++ QYWHCCGSEDPFDPGCTAAPH Sbjct: 75 HTSHFGGETKRKFESVYTGGTMSTPDSGQVFQYWHCCGSEDPFDPGCTAAPH 126 >ref|XP_002271418.1| PREDICTED: uncharacterized protein LOC100248486 [Vitis vinifera] gi|296087195|emb|CBI33569.3| unnamed protein product [Vitis vinifera] Length = 125 Score = 112 bits (279), Expect = 4e-23 Identities = 45/52 (86%), Positives = 51/52 (98%) Frame = -3 Query: 314 HTAHFGGETKRKFESVHSGGTMSTPDAGKISQYWHCCGSEDPFDPGCTAAPH 159 HTAHFGGETKRKFESV++GGTM+TPD+G++ QYWHCCGSEDPFDPGCTAAPH Sbjct: 69 HTAHFGGETKRKFESVYTGGTMNTPDSGQVLQYWHCCGSEDPFDPGCTAAPH 120 >dbj|BAJ95193.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 124 Score = 111 bits (277), Expect = 7e-23 Identities = 47/52 (90%), Positives = 48/52 (92%) Frame = -3 Query: 314 HTAHFGGETKRKFESVHSGGTMSTPDAGKISQYWHCCGSEDPFDPGCTAAPH 159 HTAHFGGETKRKFESVHSGGTM TP AGK+ QYWHCCGSEDPFD GCTAAPH Sbjct: 68 HTAHFGGETKRKFESVHSGGTMDTPGAGKVLQYWHCCGSEDPFDIGCTAAPH 119 >ref|XP_002532639.1| conserved hypothetical protein [Ricinus communis] gi|223527630|gb|EEF29742.1| conserved hypothetical protein [Ricinus communis] Length = 137 Score = 111 bits (277), Expect = 7e-23 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = -3 Query: 314 HTAHFGGETKRKFESVHSGGTMSTPDAGKISQYWHCCGSEDPFDPGCTAAPH 159 HTAHFGGETKRKFESV+SGGTM TPD+G + QYWHCCGSEDPFDPGCTAAPH Sbjct: 81 HTAHFGGETKRKFESVYSGGTMDTPDSGIVFQYWHCCGSEDPFDPGCTAAPH 132