BLASTX nr result
ID: Cnidium21_contig00027080
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00027080 (394 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004162023.1| PREDICTED: uncharacterized LOC101219406 [Cuc... 74 9e-12 ref|XP_004142251.1| PREDICTED: uncharacterized protein LOC101219... 74 9e-12 ref|XP_003601356.1| hypothetical protein MTR_3g079820 [Medicago ... 74 1e-11 ref|XP_002527563.1| conserved hypothetical protein [Ricinus comm... 74 1e-11 ref|NP_568406.1| uncharacterized protein [Arabidopsis thaliana] ... 72 5e-11 >ref|XP_004162023.1| PREDICTED: uncharacterized LOC101219406 [Cucumis sativus] Length = 133 Score = 74.3 bits (181), Expect = 9e-12 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = +3 Query: 3 RTNSGLVNPGDVGRVVSRKPKDVWAIRLSIGTYLIDERY 119 R NSG++NPGDVGR+VSRKPKDVWA+RL +GTYLID RY Sbjct: 87 RVNSGIINPGDVGRIVSRKPKDVWAVRLKVGTYLIDGRY 125 >ref|XP_004142251.1| PREDICTED: uncharacterized protein LOC101219406 [Cucumis sativus] Length = 133 Score = 74.3 bits (181), Expect = 9e-12 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = +3 Query: 3 RTNSGLVNPGDVGRVVSRKPKDVWAIRLSIGTYLIDERY 119 R NSG++NPGDVGR+VSRKPKDVWA+RL +GTYLID RY Sbjct: 87 RVNSGIINPGDVGRIVSRKPKDVWAVRLKVGTYLIDGRY 125 >ref|XP_003601356.1| hypothetical protein MTR_3g079820 [Medicago truncatula] gi|355490404|gb|AES71607.1| hypothetical protein MTR_3g079820 [Medicago truncatula] Length = 128 Score = 73.9 bits (180), Expect = 1e-11 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = +3 Query: 3 RTNSGLVNPGDVGRVVSRKPKDVWAIRLSIGTYLIDERY 119 R NSGLV PGDVGR+VSRKPKDVWA+RLSIGTYLID +Y Sbjct: 80 RVNSGLVKPGDVGRIVSRKPKDVWAVRLSIGTYLIDGKY 118 >ref|XP_002527563.1| conserved hypothetical protein [Ricinus communis] gi|223533055|gb|EEF34815.1| conserved hypothetical protein [Ricinus communis] Length = 128 Score = 73.9 bits (180), Expect = 1e-11 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = +3 Query: 3 RTNSGLVNPGDVGRVVSRKPKDVWAIRLSIGTYLIDERY 119 R NSGLV PGDVGR+VSRKPKDVWA+RLSIGTYLID +Y Sbjct: 82 RVNSGLVKPGDVGRIVSRKPKDVWAVRLSIGTYLIDGKY 120 >ref|NP_568406.1| uncharacterized protein [Arabidopsis thaliana] gi|332005525|gb|AED92908.1| uncharacterized protein [Arabidopsis thaliana] Length = 108 Score = 72.0 bits (175), Expect = 5e-11 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = +3 Query: 3 RTNSGLVNPGDVGRVVSRKPKDVWAIRLSIGTYLIDERY 119 R NSGLV PGDVGR+VSRKPKD+WA+RLSIGTYL+D +Y Sbjct: 58 RANSGLVKPGDVGRIVSRKPKDLWAVRLSIGTYLLDGKY 96