BLASTX nr result
ID: Cnidium21_contig00027059
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00027059 (313 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_002608204.1| ribosomal protein L2 [Carica papaya] gi|1705... 61 8e-08 gb|AAL48207.1|AF387186_1 ribosomal protein L2 [Lonicera sp. Palm... 60 1e-07 gb|AAL48209.1|AF387188_1 ribosomal protein L2 [Ulmus thomasii] 60 2e-07 gb|AAW30346.1| ribosomal protein L2 [Platanus occidentalis] 59 4e-07 ref|YP_173485.1| ribosomal protein L2 [Nicotiana tabacum] 59 4e-07 >ref|YP_002608204.1| ribosomal protein L2 [Carica papaya] gi|170522383|gb|ACB20493.1| ribosomal protein L2 (mitochondrion) [Carica papaya] Length = 335 Score = 61.2 bits (147), Expect = 8e-08 Identities = 24/43 (55%), Positives = 36/43 (83%) Frame = -2 Query: 312 RAKEEVGERNTFSLSDIQKWKPQSIVWAHRLKRKAAISWKTLK 184 R KE+V +NTFSL +++KW+ SI+WAHR+KRKAA+SW++ + Sbjct: 209 RMKEKVRGKNTFSLCEVRKWRTHSILWAHRIKRKAALSWQSFR 251 >gb|AAL48207.1|AF387186_1 ribosomal protein L2 [Lonicera sp. Palmer 679] Length = 228 Score = 60.5 bits (145), Expect = 1e-07 Identities = 24/43 (55%), Positives = 36/43 (83%) Frame = -2 Query: 312 RAKEEVGERNTFSLSDIQKWKPQSIVWAHRLKRKAAISWKTLK 184 R +E+V +NTFSL +I+KW+ SI+WAHR+KRKAA+SW++ + Sbjct: 151 RMREKVRGKNTFSLCEIRKWRTHSILWAHRIKRKAALSWQSFR 193 >gb|AAL48209.1|AF387188_1 ribosomal protein L2 [Ulmus thomasii] Length = 246 Score = 60.1 bits (144), Expect = 2e-07 Identities = 23/43 (53%), Positives = 36/43 (83%) Frame = -2 Query: 312 RAKEEVGERNTFSLSDIQKWKPQSIVWAHRLKRKAAISWKTLK 184 R +E+V +NTFSL +++KW+ SI+WAHR+KRKAA+SW++ + Sbjct: 181 RMREKVRGKNTFSLCEVRKWRTHSILWAHRIKRKAALSWQSFR 223 >gb|AAW30346.1| ribosomal protein L2 [Platanus occidentalis] Length = 217 Score = 58.9 bits (141), Expect = 4e-07 Identities = 23/40 (57%), Positives = 34/40 (85%) Frame = -2 Query: 312 RAKEEVGERNTFSLSDIQKWKPQSIVWAHRLKRKAAISWK 193 R +E+V +NTFSL +++KW+ SI+WAHR+KRKAA+SW+ Sbjct: 178 RMREKVRGKNTFSLCEVRKWRTHSILWAHRIKRKAALSWQ 217 >ref|YP_173485.1| ribosomal protein L2 [Nicotiana tabacum] Length = 331 Score = 58.9 bits (141), Expect = 4e-07 Identities = 23/43 (53%), Positives = 35/43 (81%) Frame = -2 Query: 312 RAKEEVGERNTFSLSDIQKWKPQSIVWAHRLKRKAAISWKTLK 184 R +E+V +NTFSL +I+KW+ SI+W HR+KRKAA+SW++ + Sbjct: 205 RMREKVRGKNTFSLCEIRKWRTHSILWVHRIKRKAALSWQSFR 247