BLASTX nr result
ID: Cnidium21_contig00026945
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00026945 (319 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002284079.1| PREDICTED: probable ribose-5-phosphate isome... 59 3e-07 ref|XP_002312428.1| predicted protein [Populus trichocarpa] gi|1... 58 9e-07 ref|XP_002282058.2| PREDICTED: probable ribose-5-phosphate isome... 57 1e-06 emb|CBI16263.3| unnamed protein product [Vitis vinifera] 57 1e-06 ref|XP_002526596.1| ribose-5-phosphate isomerase, putative [Rici... 56 3e-06 >ref|XP_002284079.1| PREDICTED: probable ribose-5-phosphate isomerase-like [Vitis vinifera] Length = 269 Score = 59.3 bits (142), Expect = 3e-07 Identities = 33/57 (57%), Positives = 44/57 (77%), Gaps = 9/57 (15%) Frame = -1 Query: 145 MALAHPNFIGSE---VDSSIMVSSESP------INLSQDELKKIAAYKAVEFVESGM 2 MA+A+P+FIGSE +++ I++S SP + L+QDELKKIAAYKAVE+VESGM Sbjct: 1 MAIAYPHFIGSEKSAMETGIILSPSSPSPSLPHVILTQDELKKIAAYKAVEYVESGM 57 >ref|XP_002312428.1| predicted protein [Populus trichocarpa] gi|118488529|gb|ABK96077.1| unknown [Populus trichocarpa] gi|222852248|gb|EEE89795.1| predicted protein [Populus trichocarpa] Length = 264 Score = 57.8 bits (138), Expect = 9e-07 Identities = 34/52 (65%), Positives = 40/52 (76%), Gaps = 4/52 (7%) Frame = -1 Query: 145 MALAHPNFIGSE---VDSSIMV-SSESPINLSQDELKKIAAYKAVEFVESGM 2 MA+ P FIGSE ++S M SS SP+ L+QDELKKIAAYKAVEFV+SGM Sbjct: 1 MAIPCPPFIGSEKLSIESGAMSPSSPSPLILTQDELKKIAAYKAVEFVQSGM 52 >ref|XP_002282058.2| PREDICTED: probable ribose-5-phosphate isomerase-like [Vitis vinifera] Length = 345 Score = 57.4 bits (137), Expect = 1e-06 Identities = 33/57 (57%), Positives = 43/57 (75%), Gaps = 9/57 (15%) Frame = -1 Query: 145 MALAHPNFIGSEVDS--SIMVSSES-------PINLSQDELKKIAAYKAVEFVESGM 2 MA+A+P+FIGS+ + + M+SS S P+ L+QDELKKIAAYKAVE+VESGM Sbjct: 1 MAIAYPHFIGSQKSAMETGMISSPSSSSPSRPPVILTQDELKKIAAYKAVEYVESGM 57 >emb|CBI16263.3| unnamed protein product [Vitis vinifera] Length = 322 Score = 57.4 bits (137), Expect = 1e-06 Identities = 33/57 (57%), Positives = 43/57 (75%), Gaps = 9/57 (15%) Frame = -1 Query: 145 MALAHPNFIGSEVDS--SIMVSSES-------PINLSQDELKKIAAYKAVEFVESGM 2 MA+A+P+FIGS+ + + M+SS S P+ L+QDELKKIAAYKAVE+VESGM Sbjct: 19 MAIAYPHFIGSQKSAMETGMISSPSSSSPSRPPVILTQDELKKIAAYKAVEYVESGM 75 >ref|XP_002526596.1| ribose-5-phosphate isomerase, putative [Ricinus communis] gi|223534036|gb|EEF35755.1| ribose-5-phosphate isomerase, putative [Ricinus communis] Length = 264 Score = 56.2 bits (134), Expect = 3e-06 Identities = 32/48 (66%), Positives = 36/48 (75%) Frame = -1 Query: 145 MALAHPNFIGSEVDSSIMVSSESPINLSQDELKKIAAYKAVEFVESGM 2 MA+ P FI SE +S+ S SP LSQDELKKIAAYKAVEFV+SGM Sbjct: 1 MAIPCPPFIASEKLASMESSPLSPPLLSQDELKKIAAYKAVEFVQSGM 48