BLASTX nr result
ID: Cnidium21_contig00026927
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00026927 (402 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002302711.1| predicted protein [Populus trichocarpa] gi|2... 65 4e-09 ref|XP_004152249.1| PREDICTED: peter Pan-like protein-like [Cucu... 64 1e-08 ref|XP_002269158.1| PREDICTED: peter Pan-like protein [Vitis vin... 62 6e-08 ref|XP_002523084.1| Protein Peter pan, putative [Ricinus communi... 62 6e-08 dbj|BAJ86679.1| predicted protein [Hordeum vulgare subsp. vulgare] 61 8e-08 >ref|XP_002302711.1| predicted protein [Populus trichocarpa] gi|222844437|gb|EEE81984.1| predicted protein [Populus trichocarpa] Length = 297 Score = 65.5 bits (158), Expect = 4e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +3 Query: 3 IPRSFVFSRGKLPGSLKQLQADLRKLRLPYTALKLK 110 IP+SFVF+RGKLPGSL+QLQ DLRKL LPYTALKLK Sbjct: 22 IPKSFVFARGKLPGSLRQLQMDLRKLMLPYTALKLK 57 >ref|XP_004152249.1| PREDICTED: peter Pan-like protein-like [Cucumis sativus] Length = 344 Score = 63.9 bits (154), Expect = 1e-08 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = +3 Query: 3 IPRSFVFSRGKLPGSLKQLQADLRKLRLPYTALKLK 110 IP+SFVFSRGKLPG LKQLQ DLRKL LPYTAL LK Sbjct: 32 IPKSFVFSRGKLPGPLKQLQMDLRKLMLPYTALNLK 67 >ref|XP_002269158.1| PREDICTED: peter Pan-like protein [Vitis vinifera] gi|297743890|emb|CBI36860.3| unnamed protein product [Vitis vinifera] Length = 330 Score = 61.6 bits (148), Expect = 6e-08 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = +3 Query: 3 IPRSFVFSRGKLPGSLKQLQADLRKLRLPYTALKLK 110 IP S VFSRGKLPGSLKQLQ DLRKL LPYTA+ LK Sbjct: 31 IPHSIVFSRGKLPGSLKQLQMDLRKLMLPYTAVNLK 66 >ref|XP_002523084.1| Protein Peter pan, putative [Ricinus communis] gi|223537646|gb|EEF39269.1| Protein Peter pan, putative [Ricinus communis] Length = 341 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +3 Query: 3 IPRSFVFSRGKLPGSLKQLQADLRKLRLPYTALKLK 110 IP+SFVF+RGKLPG L+QLQ DLRKL LPYTAL LK Sbjct: 32 IPKSFVFARGKLPGPLRQLQMDLRKLMLPYTALNLK 67 >dbj|BAJ86679.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 360 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +3 Query: 3 IPRSFVFSRGKLPGSLKQLQADLRKLRLPYTALKLK 110 IP+SFVFSRGKLP +L+ LQ DLRKL LPYTALKLK Sbjct: 58 IPKSFVFSRGKLPSTLRHLQQDLRKLMLPYTALKLK 93